KEGG   Acidilobus saccharovorans: ASAC_0030Help
Entry
ASAC_0030         CDS       T01283                                 

Definition
ATP-dependent 6-phosphofructokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
asc  Acidilobus saccharovorans
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:asc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ASAC_0030
Enzymes [BR:asc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     ASAC_0030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
35739..36701
Genome map
AA seq 320 aa AA seqDB search
MEQKDLDVVAIGHALVDLRFTVSKFASPDEEADIEEQSTGPGGSAINVALITSRLGGKAA
VITKIGLDNFGRQIVEELVRSKVDISGLKVGFGSTGFSVLMIDKEGNIVLYGYKGCAEKL
DPDEIDEKVIARGKFVHIASLRPDTSLRAAVRAKELDAMVSWDPGRRLSMAGLKALRGLI
KFVDIVELNSRECANLTGIRDPVACAEEIQRVGPSTVIVKMGPRGLYALSDDFTGYVPAF
KVSVVRDSTGSGDTFAAAMLLRLSRGDKLRDALVYAQAVAALKVTMLGANALPPIEEIEK
FYQEHRKEVEAGIADKPPAE
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggagcagaaggaccttgacgtcgtcgccatagggcacgcgctcgtcgacctcaggttc
acggtgagcaagttcgcctcccccgacgaggaggctgacatagaggagcagagcacgggc
cccggcggctcagcgataaacgtggccctgataacctcaaggctcgggggcaaggcagcc
gtaataaccaagatagggcttgacaacttcggcaggcagatagtcgaggagctggtcagg
agcaaggtcgacatatctggcctcaaggttggcttcggctcgacgggcttctcagtgctc
atgatagacaaggagggcaacatagtgctctacggctacaagggctgcgcggagaagctc
gacccagacgagatagacgagaaggtcatagctaggggcaagttcgtccacatagccagc
ctgaggcccgacacgagcctcagggcggccgtcagggccaaggagctcgacgccatggtc
tcctgggaccccgggaggaggctcagcatggctggcctgaaggccctcagggggctcata
aagttcgtcgacatagttgagcttaacagcagggagtgcgccaacctaaccggaataagg
gaccccgtggcctgcgccgaggagatacagagggtggggccctccacagtgatagtgaag
atgggccccagggggctctacgccctgagcgacgacttcacgggctacgtgccggccttc
aaggtcagcgtggtcagggactcgacgggcagcggggacaccttcgcggccgccatgctg
ctgaggctctcaaggggcgataagctcagggacgccctagtctacgcccaggccgtggcc
gccctcaaggttactatgcttggggccaacgcgctgccccccattgaggagatagagaag
ttctaccaggagcacaggaaggaggttgaggcaggcatagcggacaagccgccggctgag
tga

DBGET integrated database retrieval system