KEGG   Acidilobus saccharovorans: ASAC_0096Help
Entry
ASAC_0096         CDS       T01283                                 

Definition
Pyruvate:ferredoxin oxidoreductase (POR) and 2-oxoglutarate:ferredoxin oxidoreductase (KGOR), gamma subunitubunit
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
asc  Acidilobus saccharovorans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:asc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ASAC_0096
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASAC_0096
   00020 Citrate cycle (TCA cycle)
    ASAC_0096
   00620 Pyruvate metabolism
    ASAC_0096
   00640 Propanoate metabolism
    ASAC_0096
   00650 Butanoate metabolism
    ASAC_0096
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    ASAC_0096
   00680 Methane metabolism
    ASAC_0096
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    ASAC_0096
Enzymes [BR:asc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     ASAC_0096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
105629..106207
Genome map
AA seq 192 aa AA seqDB search
MRRSKLVMLEIRWHGRGGQGAVTASEVIASASIIEGKYALAFPEFGAERRGAPVRAYTRV
TDSPLIPRTPIEHPDVVVVLDRSLLKPSYIEGLKDGGILVANSPLKPDELLQKLGFANRY
RAATVDATSVAMKWLKANIVNTAILGALVKSTEIVKLDTVLDVIRSRFHGKIAEANVMAV
KEAYDLTQLSWR
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
gtgaggcgctcaaagttggttatgctagagatcaggtggcacggcaggggaggacaggga
gctgtaacggcgagcgaggtcatagcgtcggcgtcaatcattgagggcaagtacgcgctg
gcgttccctgagttcggcgctgagaggagaggggcgcccgtgagggcctacaccagggta
actgacagccccctcatacccaggacccccatagagcaccctgacgtggtggtcgtgctc
gacaggagcctgctcaagccctcctacatagagggcctgaaggacgggggcatcctggtg
gccaacagccccctcaagccggacgagctcctccagaagctcggcttcgccaacaggtac
agggccgcaacggtcgacgctacatcggtggccatgaagtggctgaaggccaacatagtt
aacacggcaatactgggggcgctggtcaagtcaacggagatagtaaagttagacaccgtg
ttagacgtaataaggtccaggttccatggtaagattgcggaggcgaacgtgatggcagtc
aaggaggcctacgacctgacccagctctcgtggaggtga

DBGET integrated database retrieval system