KEGG   Acidilobus saccharovorans: ASAC_0096Help
Entry
ASAC_0096         CDS       T01283                                 

Definition
(GenBank) Pyruvate:ferredoxin oxidoreductase (POR) and putative 2-oxoglutarate:ferredoxin oxidoreductase (KGOR), gamma subunitubunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
asc  Acidilobus saccharovorans
Pathway
asc00010  Glycolysis / Gluconeogenesis
asc00020  Citrate cycle (TCA cycle)
asc00620  Pyruvate metabolism
asc00640  Propanoate metabolism
asc00650  Butanoate metabolism
asc00680  Methane metabolism
asc00720  Carbon fixation pathways in prokaryotes
asc01100  Metabolic pathways
asc01120  Microbial metabolism in diverse environments
asc01130  Biosynthesis of antibiotics
asc01200  Carbon metabolism
Module
asc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:asc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASAC_0096
   00020 Citrate cycle (TCA cycle)
    ASAC_0096
   00620 Pyruvate metabolism
    ASAC_0096
   00640 Propanoate metabolism
    ASAC_0096
   00650 Butanoate metabolism
    ASAC_0096
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    ASAC_0096
   00680 Methane metabolism
    ASAC_0096
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    ASAC_0096
Enzymes [BR:asc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     ASAC_0096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: ADL18504
UniProt: D9PZL6
Position
105629..106207
Genome map
AA seq 192 aa AA seqDB search
MRRSKLVMLEIRWHGRGGQGAVTASEVIASASIIEGKYALAFPEFGAERRGAPVRAYTRV
TDSPLIPRTPIEHPDVVVVLDRSLLKPSYIEGLKDGGILVANSPLKPDELLQKLGFANRY
RAATVDATSVAMKWLKANIVNTAILGALVKSTEIVKLDTVLDVIRSRFHGKIAEANVMAV
KEAYDLTQLSWR
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
gtgaggcgctcaaagttggttatgctagagatcaggtggcacggcaggggaggacaggga
gctgtaacggcgagcgaggtcatagcgtcggcgtcaatcattgagggcaagtacgcgctg
gcgttccctgagttcggcgctgagaggagaggggcgcccgtgagggcctacaccagggta
actgacagccccctcatacccaggacccccatagagcaccctgacgtggtggtcgtgctc
gacaggagcctgctcaagccctcctacatagagggcctgaaggacgggggcatcctggtg
gccaacagccccctcaagccggacgagctcctccagaagctcggcttcgccaacaggtac
agggccgcaacggtcgacgctacatcggtggccatgaagtggctgaaggccaacatagtt
aacacggcaatactgggggcgctggtcaagtcaacggagatagtaaagttagacaccgtg
ttagacgtaataaggtccaggttccatggtaagattgcggaggcgaacgtgatggcagtc
aaggaggcctacgacctgacccagctctcgtggaggtga

DBGET integrated database retrieval system