KEGG   Acidilobus saccharovorans: ASAC_0098Help
Entry
ASAC_0098         CDS       T01283                                 

Definition
Pyruvate:ferredoxin oxidoreductase (POR), alpha subunit
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
asc  Acidilobus saccharovorans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:asc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ASAC_0098
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASAC_0098
   00020 Citrate cycle (TCA cycle)
    ASAC_0098
   00620 Pyruvate metabolism
    ASAC_0098
   00640 Propanoate metabolism
    ASAC_0098
   00650 Butanoate metabolism
    ASAC_0098
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    ASAC_0098
   00680 Methane metabolism
    ASAC_0098
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    ASAC_0098
Enzymes [BR:asc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     ASAC_0098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
106538..107731
Genome map
AA seq 397 aa AA seqDB search
MQAQVQYKRPIPLSTNYAVAHAAKDLDVDVIAAYPITPQTTVVEKLSEFVANGELDAEFI
HVESEHSALSATLAASLAGARAFTATASQGLAFMHEMLHVASGLRAPIVMSVAMRALSAP
ISIWNDQTDLFNARDAGWIIYFVHTAQEAYDTIIQAYRLAEDRDVLLPVMVGYDGYVMSH
TTEPVVVEDRESVLKFAPKRPYPYRLDPDHPVTIGPIVPPEYYYEIKYQQVKAMEGVPEK
AEEIDREFGKTFGRSYGIMECYMCDGAEALIVANASYAATMKSVLPDAWKQGLKVGLLRL
RLYRPFPVKHFVNYTSNVKSVLVIDRAISYGAPYQGPLANEIAGLKVREDLGFNLTSVVA
GIGQRAMENEDFLAIARLAWEARTRKYPETIFYGVRE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggcacaggtccagtacaagaggcccatacccctgagcactaactacgcggtggcc
cacgcggccaaggacttagacgttgacgtcatagcggcctaccctataaccccgcagacc
acggtggtcgagaagctctcagagttcgtcgccaacggcgagcttgacgctgagttcata
cacgtggaaagcgagcacagcgcccttagcgccaccctggccgcctcgctggcgggcgcg
agggccttcaccgccacggccagccagggactggcattcatgcacgagatgcttcacgtg
gcctctggcctgagggcccccatagtcatgagcgtagccatgagggccctcagcgcaccg
ataagcatatggaacgaccagacggacctgttcaacgcgagggacgccggctggataatc
tacttcgtccacactgcccaggaggcctacgacaccataatacaggcctacaggctcgcc
gaggacagggacgtgctgctgcccgtcatggtgggctatgacggctacgtcatgagccac
accacagagcccgtggtggtcgaggacagggagtccgtgctcaagttcgcgcccaagagg
ccctacccgtacaggcttgacccggaccacccggtgaccataggacccatagtgccgcct
gagtactactatgagataaagtaccagcaggtcaaggccatggagggggtgccggagaag
gctgaggagatagacagggagttcggcaagaccttcggcaggagctacggcatcatggag
tgctacatgtgcgacggagctgaggcgctaatagttgctaacgccagctacgccgccacc
atgaagagcgtgctgccggacgcctggaagcagggactcaaggtaggcctgctgaggctc
aggctctacaggccgttcccagtcaagcacttcgtcaactacacgtccaacgtgaagagc
gtgcttgtaatagacagggccataagctacggcgcgccctaccaggggcctctggccaac
gagatagccggcctcaaggtcagggaggacctcggcttcaacctgaccagcgtcgtggca
ggcatagggcagagggccatggagaacgaggacttcttggctattgctcgcctggcctgg
gaggccaggacgaggaagtaccctgagaccatattctatggggtgagggagtga

DBGET integrated database retrieval system