KEGG   Acidilobus saccharovorans: ASAC_0098Help
Entry
ASAC_0098         CDS       T01283                                 

Definition
Pyruvate:ferredoxin oxidoreductase (POR), alpha subunit
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
asc  Acidilobus saccharovorans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:asc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ASAC_0098
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASAC_0098
   00020 Citrate cycle (TCA cycle)
    ASAC_0098
   00620 Pyruvate metabolism
    ASAC_0098
   00640 Propanoate metabolism
    ASAC_0098
   00650 Butanoate metabolism
    ASAC_0098
  Energy metabolism
   00680 Methane metabolism
    ASAC_0098
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    ASAC_0098
Enzymes [BR:asc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     ASAC_0098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
106538..107731
Genome map
AA seq 397 aa AA seqDB search
MQAQVQYKRPIPLSTNYAVAHAAKDLDVDVIAAYPITPQTTVVEKLSEFVANGELDAEFI
HVESEHSALSATLAASLAGARAFTATASQGLAFMHEMLHVASGLRAPIVMSVAMRALSAP
ISIWNDQTDLFNARDAGWIIYFVHTAQEAYDTIIQAYRLAEDRDVLLPVMVGYDGYVMSH
TTEPVVVEDRESVLKFAPKRPYPYRLDPDHPVTIGPIVPPEYYYEIKYQQVKAMEGVPEK
AEEIDREFGKTFGRSYGIMECYMCDGAEALIVANASYAATMKSVLPDAWKQGLKVGLLRL
RLYRPFPVKHFVNYTSNVKSVLVIDRAISYGAPYQGPLANEIAGLKVREDLGFNLTSVVA
GIGQRAMENEDFLAIARLAWEARTRKYPETIFYGVRE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggcacaggtccagtacaagaggcccatacccctgagcactaactacgcggtggcc
cacgcggccaaggacttagacgttgacgtcatagcggcctaccctataaccccgcagacc
acggtggtcgagaagctctcagagttcgtcgccaacggcgagcttgacgctgagttcata
cacgtggaaagcgagcacagcgcccttagcgccaccctggccgcctcgctggcgggcgcg
agggccttcaccgccacggccagccagggactggcattcatgcacgagatgcttcacgtg
gcctctggcctgagggcccccatagtcatgagcgtagccatgagggccctcagcgcaccg
ataagcatatggaacgaccagacggacctgttcaacgcgagggacgccggctggataatc
tacttcgtccacactgcccaggaggcctacgacaccataatacaggcctacaggctcgcc
gaggacagggacgtgctgctgcccgtcatggtgggctatgacggctacgtcatgagccac
accacagagcccgtggtggtcgaggacagggagtccgtgctcaagttcgcgcccaagagg
ccctacccgtacaggcttgacccggaccacccggtgaccataggacccatagtgccgcct
gagtactactatgagataaagtaccagcaggtcaaggccatggagggggtgccggagaag
gctgaggagatagacagggagttcggcaagaccttcggcaggagctacggcatcatggag
tgctacatgtgcgacggagctgaggcgctaatagttgctaacgccagctacgccgccacc
atgaagagcgtgctgccggacgcctggaagcagggactcaaggtaggcctgctgaggctc
aggctctacaggccgttcccagtcaagcacttcgtcaactacacgtccaacgtgaagagc
gtgcttgtaatagacagggccataagctacggcgcgccctaccaggggcctctggccaac
gagatagccggcctcaaggtcagggaggacctcggcttcaacctgaccagcgtcgtggca
ggcatagggcagagggccatggagaacgaggacttcttggctattgctcgcctggcctgg
gaggccaggacgaggaagtaccctgagaccatattctatggggtgagggagtga

DBGET integrated database retrieval system