KEGG   Acidilobus saccharovorans: ASAC_0147Help
Entry
ASAC_0147         CDS       T01283                                 

Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
asc  Acidilobus saccharovorans
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:asc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ASAC_0147
Enzymes [BR:asc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     ASAC_0147
Peptidases [BR:asc01002]
 Cysteine Peptidases
  Family C44
   ASAC_0147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
155438..156460
Genome map
AA seq 340 aa AA seqDB search
MSCEALGLRLLSRVGDLLRRSSCDCVLFSGGIDTSFVTLAAVEAGLRPKLITVLFQGSAD
EPYAEYVSKVLGLDLIKVRPTPEEALECIDVALRSMVTIDPIEAVSGSAVCLGLRKAREL
GCRCVATGDGGDELFIGYDFLFGRDRNYLDGWLSRVASSAFFNSVPISAQLGVTVLLPLY
SDDAKAISREAFNEGCDVRDVNGTTYGKYLMRRVLELKGLSLVAWRRKDPITRGSGSERL
LGLMSSLVGDEEVRSLTSLTGVLVPSRPHAYLLGRRLSLRLPMPGKATRNLCPICGSELR
DGFCRFCGAYIDEAGSLSVYSDDASNISGASRLLSKGPKG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
ttgagctgcgaggccctgggcctcaggctccttagccgtgtgggcgacctgctcaggagg
agctcctgcgactgcgtgcttttcagcggcggcatagacaccagctttgtcaccctcgca
gccgtggaggccggcctgaggcctaagctgatcacagtcctctttcaggggtccgccgat
gagccatacgctgagtacgtctccaaggtgcttgggcttgacctaattaaagtgaggccg
acccccgaggaggcccttgagtgcatcgacgtcgccctaaggtcgatggttaccatagac
cccattgaggctgtctcgggaagcgcggtgtgtctcgggctcaggaaggccagggagctc
ggctgcaggtgcgtggcaaccggcgacggaggggacgagctattcattggctatgacttc
ctgttcggcagggacaggaattaccttgatggctggctcagcagggtggccagcagcgcc
ttcttcaactcagttcccatatcagcccagctcggcgtcaccgtgctcctgcccctctac
agcgatgatgccaaggcaatctcgcgggaggcctttaatgaggggtgcgacgtcagggat
gttaacggaaccacctacggcaagtacctcatgaggagggtcctggagctcaagggcctc
agcctggtggcctggaggaggaaggaccccataaccaggggcagcggctcagagcggctg
ctgggcctcatgtcgtccctggtgggagatgaagaggtcaggagtctgacctcgcttacg
ggcgtgctggtgccctcaaggcctcacgcctacctgctgggcaggaggctgtccctcagg
ctccctatgcctggcaaggcgacgaggaacctctgtcccatatgcgggtccgagcttagg
gacggcttctgcaggttctgcggcgcctacatcgacgaggcagggagcctctccgtctac
tccgacgacgcgtccaacatatctggggcctccaggctcctctcaaagggccctaagggc
tga

DBGET integrated database retrieval system