KEGG   Acidilobus saccharovorans: ASAC_0245Help
Entry
ASAC_0245         CDS       T01283                                 

Definition
(GenBank) Glyceraldehyde-3-phosphate:ferredoxin oxidoreductase (GAPOR)
  KO
K11389  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
asc  Acidilobus saccharovorans
Pathway
asc00010  Glycolysis / Gluconeogenesis
asc01100  Metabolic pathways
asc01120  Microbial metabolism in diverse environments
asc01200  Carbon metabolism
asc01230  Biosynthesis of amino acids
Module
asc_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:asc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASAC_0245
Enzymes [BR:asc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.6  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin)
     ASAC_0245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_N AFOR_C RTP1_C2
Motif
Other DBs
NCBI-ProteinID: ADL18652
UniProt: D9Q014
Position
241913..243865
Genome map
AA seq 650 aa AA seqDB search
MGFKVLYVDATKRSYKIESINDPELFGIVDLGLQIHLDMKSYNVDPLDPANPLVLGIGPF
AGGAVVGSHRIVAIFKSPESRGLHVSEMGGAGYSFFRTGLDAIVITGRSERPLLIRVIGG
SNGEVSVDFSDISFDELNRIYSNYSGLSGTKALTKYVVDMDRDLIVKNHARVAVVGPGAY
KTLFAGIFSYVLDDKGNLTEVSDSASRGGGGSVMAQAHNVVAITFGGTYKRPNPNLSNVQ
ILNKITQEVYKKPFSQALLDKTTKYRFDPASKTGGTFGENYPHYKELVPVLNYNHVYLSR
GLRLELHGKIMDYFWRPFQDEVFDGGKLTPASKNCGEPCPVVCKKIFNKVKIDYEPAHGV
GPISGIFDIKKSAELVDLVDNLGLDAIEAGHFVGWIFDLIDKGLLNPEDVGLDKRPVMDP
KLQGLEASKVNAELARKLLINLVSDDTTKVLKIVGSMGLRAAAKELDNLYSDRVAKSGVK
FEDLLVYAAFGKSGYFTPNFYWSPGVLAPLFVLGKYWTDYSPAFREPEDYASAALRRAVM
ELLIANAGFCRFHRGWAEEALAGLYKEMLGVDLDVYKHGLLTYKRIAEYQAKSEATPEPW
ESRKVMDAIASLAAETGVHGWEDSMYHTEKMAEWWNRFYKKLQEELNKVS
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggggttcaaagtgctttatgtcgatgccacaaaacgttcttataagatcgaatccata
aacgacccagagctctttgggatagttgaccttgggcttcagatacacttagacatgaag
agttataacgtagaccctctggaccctgccaatccccttgtgcttggaataggacccttt
gcaggcggcgccgttgttggcagccacagaatagtggccatcttcaagagcccagagagc
aggggcctccacgtgagcgagatgggaggggccggctactcattcttcaggactggactt
gacgcaattgtgattaccggcagaagcgagaggcccctgctcataagggttataggtggc
tctaacggcgaagtctccgtggacttctcggatataagctttgacgagcttaacaggata
tactcgaactactcagggctcagcggcactaaagcgctaactaagtacgttgttgacatg
gacagggacctcatagttaagaatcacgccagagtggctgtggtggggcctggagcctat
aagaccctcttcgcaggtatcttcagctacgtcctagatgacaaaggcaacttgacagaa
gtctcggactcggcctctaggggcggcgggggctctgttatggcacaggcgcacaacgtt
gtggccataacttttggtgggacttacaagaggcctaatccaaacctttcaaatgttcag
atactcaacaagatcacacaggaggtctacaagaagcccttctcgcaggcgctccttgac
aagactaccaagtataggtttgacccagcctctaagacgggaggcacgtttggcgagaac
tacccacactacaaagaacttgttccagtgctcaattataaccacgtgtacttaagtcgt
ggcctcaggcttgaactacacgggaaaattatggactacttctggcgtccattccaggac
gaggtctttgacggaggaaagctcacgcctgcctccaagaactgcggcgagccgtgccct
gtcgtctgcaagaaaatatttaataaggtcaagatagactatgagcctgcccatggagtt
ggtcccataagtgggatctttgacataaagaagagcgcagagctagtggacctggttgat
aacctgggactcgatgccatagaggcaggccacttcgtgggatggatattcgacctcata
gacaagggattgctgaacccagaagatgtggggcttgacaagaggccggtgatggatcca
aagctccagggtctggaggccagcaaggtgaacgctgagctggccaggaagctcctcata
aacctagtaagcgatgataccactaaagtccttaagatagtgggctccatggggctcagg
gccgcggccaaggagctcgacaacctctacagcgaccgcgtggccaagagcggtgttaag
tttgaggatctcctggtgtatgcagcctttggcaagagcggttacttcacaccgaacttt
tactggtcgccaggggtcctcgcgccgctcttcgtgcttggcaaatactggaccgactac
tcgccggcatttagagagcctgaggactacgcctccgcagcgctacggcgcgcggtgatg
gaactgctaatagcaaacgccgggttctgcaggttccacaggggctgggccgaagaggcc
cttgcgggcctctataaggagatgcttggggttgacctggacgtctataaacatggcctc
ttgacctataagagaatagccgagtatcaggccaaatccgaggctacgccagagccttgg
gagtccagaaaagtcatggacgccatagcttctctcgctgctgagacaggcgtacatggc
tgggaggactccatgtaccacaccgagaaaatggctgagtggtggaacaggttctacaag
aaactccaggaagagctgaataaggtctcttga

DBGET integrated database retrieval system