KEGG   Acidilobus saccharovorans: ASAC_0245Help
Entry
ASAC_0245         CDS       T01283                                 

Definition
glyceraldehyde-3-phosphate:ferredoxin oxidoreductase (GAPOR)
Orthology
K11389  
glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
asc  Acidilobus saccharovorans
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:asc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ASAC_0245
   01230 Biosynthesis of amino acids
    ASAC_0245
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASAC_0245
Enzymes [BR:asc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.6  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin)
     ASAC_0245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
241913..243865
Genome map
AA seq 650 aa AA seqDB search
MGFKVLYVDATKRSYKIESINDPELFGIVDLGLQIHLDMKSYNVDPLDPANPLVLGIGPF
AGGAVVGSHRIVAIFKSPESRGLHVSEMGGAGYSFFRTGLDAIVITGRSERPLLIRVIGG
SNGEVSVDFSDISFDELNRIYSNYSGLSGTKALTKYVVDMDRDLIVKNHARVAVVGPGAY
KTLFAGIFSYVLDDKGNLTEVSDSASRGGGGSVMAQAHNVVAITFGGTYKRPNPNLSNVQ
ILNKITQEVYKKPFSQALLDKTTKYRFDPASKTGGTFGENYPHYKELVPVLNYNHVYLSR
GLRLELHGKIMDYFWRPFQDEVFDGGKLTPASKNCGEPCPVVCKKIFNKVKIDYEPAHGV
GPISGIFDIKKSAELVDLVDNLGLDAIEAGHFVGWIFDLIDKGLLNPEDVGLDKRPVMDP
KLQGLEASKVNAELARKLLINLVSDDTTKVLKIVGSMGLRAAAKELDNLYSDRVAKSGVK
FEDLLVYAAFGKSGYFTPNFYWSPGVLAPLFVLGKYWTDYSPAFREPEDYASAALRRAVM
ELLIANAGFCRFHRGWAEEALAGLYKEMLGVDLDVYKHGLLTYKRIAEYQAKSEATPEPW
ESRKVMDAIASLAAETGVHGWEDSMYHTEKMAEWWNRFYKKLQEELNKVS
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atggggttcaaagtgctttatgtcgatgccacaaaacgttcttataagatcgaatccata
aacgacccagagctctttgggatagttgaccttgggcttcagatacacttagacatgaag
agttataacgtagaccctctggaccctgccaatccccttgtgcttggaataggacccttt
gcaggcggcgccgttgttggcagccacagaatagtggccatcttcaagagcccagagagc
aggggcctccacgtgagcgagatgggaggggccggctactcattcttcaggactggactt
gacgcaattgtgattaccggcagaagcgagaggcccctgctcataagggttataggtggc
tctaacggcgaagtctccgtggacttctcggatataagctttgacgagcttaacaggata
tactcgaactactcagggctcagcggcactaaagcgctaactaagtacgttgttgacatg
gacagggacctcatagttaagaatcacgccagagtggctgtggtggggcctggagcctat
aagaccctcttcgcaggtatcttcagctacgtcctagatgacaaaggcaacttgacagaa
gtctcggactcggcctctaggggcggcgggggctctgttatggcacaggcgcacaacgtt
gtggccataacttttggtgggacttacaagaggcctaatccaaacctttcaaatgttcag
atactcaacaagatcacacaggaggtctacaagaagcccttctcgcaggcgctccttgac
aagactaccaagtataggtttgacccagcctctaagacgggaggcacgtttggcgagaac
tacccacactacaaagaacttgttccagtgctcaattataaccacgtgtacttaagtcgt
ggcctcaggcttgaactacacgggaaaattatggactacttctggcgtccattccaggac
gaggtctttgacggaggaaagctcacgcctgcctccaagaactgcggcgagccgtgccct
gtcgtctgcaagaaaatatttaataaggtcaagatagactatgagcctgcccatggagtt
ggtcccataagtgggatctttgacataaagaagagcgcagagctagtggacctggttgat
aacctgggactcgatgccatagaggcaggccacttcgtgggatggatattcgacctcata
gacaagggattgctgaacccagaagatgtggggcttgacaagaggccggtgatggatcca
aagctccagggtctggaggccagcaaggtgaacgctgagctggccaggaagctcctcata
aacctagtaagcgatgataccactaaagtccttaagatagtgggctccatggggctcagg
gccgcggccaaggagctcgacaacctctacagcgaccgcgtggccaagagcggtgttaag
tttgaggatctcctggtgtatgcagcctttggcaagagcggttacttcacaccgaacttt
tactggtcgccaggggtcctcgcgccgctcttcgtgcttggcaaatactggaccgactac
tcgccggcatttagagagcctgaggactacgcctccgcagcgctacggcgcgcggtgatg
gaactgctaatagcaaacgccgggttctgcaggttccacaggggctgggccgaagaggcc
cttgcgggcctctataaggagatgcttggggttgacctggacgtctataaacatggcctc
ttgacctataagagaatagccgagtatcaggccaaatccgaggctacgccagagccttgg
gagtccagaaaagtcatggacgccatagcttctctcgctgctgagacaggcgtacatggc
tgggaggactccatgtaccacaccgagaaaatggctgagtggtggaacaggttctacaag
aaactccaggaagagctgaataaggtctcttga

DBGET integrated database retrieval system