KEGG   Acidilobus saccharovorans: ASAC_0391Help
Entry
ASAC_0391         CDS       T01283                                 

Definition
Protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
asc  Acidilobus saccharovorans
Brite
Enzymes [BR:asc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     ASAC_0391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
395864..396535
Genome map
AA seq 223 aa AA seqDB search
MAGLKQDAFEVARRKLVDDLKLRGYLKSQAIERAMLSVPRELFVPEGVRDRAYEDRPLPI
GYGQTISAPSMVAYMTELLEVSEGMKVLEVGTGSGYQAAILAMIVGDRGHVWTVERIAEL
ASRAKETIESLGLGGRVTVIVGDGSLGYPPAAPYDRIIVTAASPKVPRPLVEQLAEGGLM
VIPVGSKEEQVLTIVRKREGQVFQQSDIEVLFVPLVGAEAWDH
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
ttggccggcttaaagcaggacgcctttgaagtggccagaaggaagcttgtagatgatctt
aagctaagggggtatctgaagagccaggcaatcgagagggccatgctgagcgttccaagg
gagctcttcgtgcctgagggggtcagggaccgggcttatgaagacaggccgctccccata
ggttatgggcagaccataagtgcgccgagcatggtagcctacatgacggagctcttagag
gtctcagaaggcatgaaggtcctcgaggttgggacggggtcaggctaccaggcggcgatc
ctggctatgattgtaggtgacagggggcacgtgtggactgtggagcgcatagcagagctt
gcaagtagagccaaggagaccatagagtccctaggcctcggaggaagggtcaccgtaatc
gtgggcgacgggagcctaggatatccaccggcggcgccctacgataggataatagtgacc
gccgcgtccccaaaggtcccaaggccgctcgtggagcagctcgcagaaggaggcctcatg
gttatacctgtgggaagcaaggaggagcaggtgcttaccatagtcagaaagagggagggc
caggtctttcaacagagcgacatagaggttctttttgtccccctggtcggggctgaggcg
tgggaccattag

DBGET integrated database retrieval system