KEGG   Acidilobus saccharovorans: ASAC_0539Help
Entry
ASAC_0539         CDS       T01283                                 

Definition
(RefSeq) acyl-CoA ligase (EC:6.2.1.1)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
asc  Acidilobus saccharovorans
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:asc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ASAC_0539
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASAC_0539
   00620 Pyruvate metabolism
    ASAC_0539
   00640 Propanoate metabolism
    ASAC_0539
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    ASAC_0539
   00680 Methane metabolism
    ASAC_0539
Enzymes [BR:asc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ASAC_0539
Lipid biosynthesis proteins [BR:asc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ASAC_0539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
534663..536582
Genome map
AA seq 639 aa AA seqDB search
MSKVTEEIYSVRKLQALSSLASKDPAAFWAQQVDLIDWFQRPAKVLEGSPPTERWFAGGL
MNVSYNAVDRHLRDKADKVAFYWTNESLDYRAITFRELYYQVNRAAYVLRQLGVKRGDVV
SMIMPSIPEAVYFGLAVHRLGAILAIHYVGLSDDVMAFRLQDAGSKVLVVASKGFRAGQE
IRIKDIADRVLNNFKTPVEKVLVVSRGFSDFNVNGSRDVVYEDIAPRGKVYVPPEPVDAS
DVGTIYYTSGTTGRPKGITQTQGGYAVALNWTFKALFNLGPSDVWWTISELGWPVWPMAN
LYTAPVMGVTAVLFEGFVGQRPDLFAKVVERFGVTHVWSSTTTLYTLKGLGSESVTGGDT
STLRIILNTGEPLNVGAWQWFRENLPNTYIGDAYWMTEHLSPIAATPYGIAEIPFRPGSA
GIAFSPTRVLIVDDEGKQLPPGNKGYIVLSPYTPALGKMWNDPNYERYIKTYWSRFPGYF
YTGDYGYMDEDGYLYVLGRADDVIATTGQRIGTMEVESTIGTHPAVAEVAAASMPLPGGK
GSALLAFVVLRPGYQPSDQLAEDIKAYARNAGYIVDRVVFVRKLPKTKSGKIMRRLLRAA
LNQEPLGDTSTLDDPAAFEDTRRMIEQVREEFRKLLQQS
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
ttgtccaaggttacggaggagatatactctgtaaggaagctccaggccctctcctccctg
gcctcaaaggacccggccgccttctgggcgcagcaggtggacctgatagactggttccag
aggccggcgaaggtcctcgaggggagcccgccgaccgagaggtggttcgcaggaggcctc
atgaacgtctcatataacgccgtggacaggcacctcagggacaaggccgacaaggtggcc
ttctactggaccaacgagtccctggactacagggcaataacgttcagggagctgtactac
caggtcaacagggccgcctacgtcctgaggcagcttggcgtcaagcgcggtgacgtggtc
tcgatgataatgccgagcatacctgaggccgtctactttggcctggccgtccacaggctt
ggggcgatactggcgatacactacgttgggctcagtgacgacgtaatggccttcaggctc
caggacgccgggtcaaaggtcctggtggtcgcgtccaagggcttcagggccggccaggag
ataaggataaaggacatagccgacagggtgctcaacaacttcaagactcccgtcgagaag
gtcctggtggtcagcaggggcttcagcgacttcaacgtcaacggcagccgtgacgtggtc
tatgaggacatagctcccagggggaaggtctacgtgccgccggagcccgtggacgcgagc
gacgtggggaccatatactacacgagcggcaccaccggcaggcccaaggggataacccag
acgcagggaggctacgcggtggcgcttaactggacgttcaaggcgctgttcaacctgggg
cccagcgacgtctggtggaccatatctgagctggggtggccggtgtggcccatggcaaac
ctctacacggcccctgtcatgggcgtgactgccgtgctcttcgagggcttcgtgggccag
aggccagacctcttcgccaaggtggttgagaggtttggggtcacccacgtgtggtcctca
acgaccacgctctacactctgaagggcctgggctcggagtcggtgacgggaggcgacacg
tccacactgaggataatactcaacaccggggagccgctcaacgtgggcgcctggcagtgg
ttcagggagaacctgcccaacacgtacataggcgacgcgtactggatgacggagcacctg
agccccatagccgcgacgccctacggcatagccgagatcccattcaggccaggctccgcc
gggatagccttctcgcccaccagggtcctcatagttgacgacgagggcaagcagctcccg
cccggcaacaagggctacatagtgctgagcccctacacgccggccctgggcaagatgtgg
aacgaccccaactatgagaggtacattaagacctactggtcaaggttcccgggctacttc
tacacgggcgactacggctacatggatgaggacggctacctctacgtgcttggcagggcg
gacgacgtcatagccaccacgggccagaggataggcaccatggaggtcgagagcaccata
ggcactcaccccgcggttgccgaggtggccgcggccagcatgccgctgcccggaggcaag
ggctcggcgctgctggccttcgttgtgctcaggcccggctaccagcccagcgaccagctg
gccgaggacataaaggcctacgccaggaacgccggctacatagttgacagggttgtattc
gtgaggaagctgccaaagaccaagagcgggaagataatgaggaggctgctgagggcagcg
cttaaccaggagccgctgggcgacacctcaacccttgacgacccagcagcctttgaggac
accaggaggatgatagagcaggtgagggaggagttcaggaagctgctgcagcagtcgtaa

DBGET integrated database retrieval system