KEGG   Acidilobus saccharovorans: ASAC_0573Help
Entry
ASAC_0573         CDS       T01283                                 

Definition
arginase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
asc  Acidilobus saccharovorans
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asc00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ASAC_0573
Enzymes [BR:asc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     ASAC_0573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(570158..571132)
Genome map
AA seq 324 aa AA seqDB search
MKKWMLFDGTTLKRLLQLHYKVGESLSLVKRARFLKDPYDRRVGEVEPLIPLAGVPWDWS
TAGRPGARFAPSAIRTELYSLTPLSEDLGELRWGFDDMGDIDIVGGDIIETGRRVVEASR
HVMEVAMSRGVPAIFIGGDHSITNWTSRPFVEQGASLVVLDAHYDIRKLTEGVTSGSWLR
ELVEATKVKALVVGVSEYVNPPYAPSRAKELGVDIISRVELLKDFKSSLERLRSLVAGSK
VYLSIDMDHLAQAFAPGVNSPTPLGMTPFESMSVIDTIASSAKVVGIDVVEVVPGADVTG
STPRLAAALLLRAVQRSLVSMNMK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaagtggatgctgttcgatggcactacattaaaaaggctgttgcagctacactat
aaggtaggtgaaagcttgagtctagtcaaaagggcccgctttttgaaggacccttatgac
aggagagttggagaagtagagcccttaattccgcttgctggcgtcccatgggattggtca
actgctggcaggcccggggctaggtttgccccttcagccataaggacagaactttactcg
ctgacaccactctccgaagaccttggagagctaaggtggggttttgatgatatgggtgac
attgatattgtaggaggcgatattatagagaccggccgaagggttgttgaagcctcaagg
cacgtcatggaggtagcgatgtccagaggggttccggctattttcattggaggcgaccac
tcaataactaactggacgtctaggcccttcgtagagcaaggcgcttccttggtagttctt
gatgcacactatgatataagaaaactgacggaaggcgttaccagtggatcgtggctaagg
gagttagttgaagccactaaagtcaaggcacttgtcgtcggagtatctgagtatgtaaac
cctccttacgccccttctagagctaaggagctgggagttgatattatcagcagggtcgaa
ctgctaaaggacttcaagtcgtctcttgagaggctaaggtcgctagtagctggttccaaa
gtctatctgagcatagatatggatcacctggcccaagcctttgcgcctggagtcaacagt
cctacccctcttggtatgactcctttcgaaagcatgagcgtaatagatacaatagcgtca
tcagctaaggtcgtgggaatagacgtagtcgaggtagtgccaggggcagacgttacaggt
tctacgcctaggctggcagctgccctacttctaagggctgtacagagatcgctggtctcg
atgaacatgaagtaa

DBGET integrated database retrieval system