KEGG   Acidilobus saccharovorans: ASAC_0698Help
Entry
ASAC_0698         CDS       T01283                                 

Definition
aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
asc  Acidilobus saccharovorans
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:asc01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:asc00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(703605..705398)
Genome map
AA seq 597 aa AA seqDB search
MGSFSRLIRVDLGSGEVKYDELRDEDVRAYLGGRGIGLLLALKGGYGRPQDPLSPELPLI
IASGPLSGAGIPLSSRATAVFFSPLSRRWSYSTVGGSLAVIMRYAGADVLMVTGRAQRPS
YIVVEGGRAEVRDASGLWGMGTFDAERALKEVHGQEAAVAVIGPAGENLVPFASINHETW
RQFGRSGGGAVMGSKNLKAVVFVPSGRSIEVADPERTWSMISYMTQRLATAAKSYRDNGT
LGTIDAANGTGFFPSLYWTGVSAPGWRRISWYEVLSKNYYVGKRATCLHCPVACHKVVTS
RRYGGYYELEYETTMALAGLTGVVDPDELIQLASLVDDVGLDTISTGNVLGLLAYLTEKG
YVDPSEGVRFGDAQRFRELITAIAKREGIGKVLSMGTREAARALGHPEVAIEVKGLEPAG
YDPRTLKGMILTYAVAERGADHLWSSGYAIDIPGLAGGRQATGEEKVRAVMDLEERNAIY
DSAVLCKFGRNAYGWSELVQVLNAVTGFSYDQASLRETAERIIVIHRYMNGTTVEDDKLP
PRWLNEPVEFDGKRYVVAEEEWRRMVMTYYKLRGYDEEGRPTRETLERLGILKAAGG
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
ttggggagcttcagcaggctcataagggtcgacctgggcagcggcgaggtgaagtacgac
gagctgagggacgaggacgtgagggcctacctggggggcaggggcataggactcctgctc
gcgcttaaggggggctacggcaggccccaggaccccctctcgccggagctgcccctcata
attgcgtccggccccctctcaggcgccggaatacccctctcgtcgagggccacggccgtg
ttcttctcgccgctgagcaggaggtggagctactccacggtggggggctccctggctgtg
ataatgaggtacgcgggggccgacgtgctaatggtgacgggcagggcccagaggccctca
tacatagtggtcgaggggggcagggccgaggtcagggacgcctcgggcctctggggcatg
gggaccttcgacgccgagagggcgcttaaggaggtccacggccaggaggcggcggtggcg
gtcataggcccggcgggggagaacctggtgccattcgcctccataaatcatgagacgtgg
aggcagttcggcaggtcaggcggaggcgcggtcatgggctcaaagaacctgaaggctgta
gtcttcgtgccgagcggcaggtccatcgaggtcgcggaccccgagaggacctggtcaatg
ataagctacatgacccagaggctcgcgacggcagctaaaagctacagggacaacgggacc
ctgggcaccatagacgcggccaacggcaccggcttcttcccctcgctctactggaccggg
gtgtcggccccgggctggaggaggatctcgtggtacgaggtgctcagcaagaactactac
gtcgggaagagggccacgtgcctccactgccccgtggcctgccacaaggtggtcacctcc
aggaggtacgggggctactacgagctggagtacgagaccacaatggccttggccggcctg
acgggcgtcgtggacccggacgagcttatacagctcgcctccctggttgacgacgtgggg
ctggacaccataagcactggcaacgtgctcggcctgctggcgtacctgacggagaagggc
tacgtggacccatcagagggcgtgaggtttggggacgcgcagcgcttcagggagctcata
acggccatagcaaagagggagggcataggcaaggtgctctccatggggaccagggaggcc
gccagggccctggggcaccccgaggtggccatagaggtcaagggccttgaacctgcgggc
tacgacccgaggacgctgaagggcatgatactgacatatgctgtagcggagaggggcgcg
gaccacctgtggagcagcggctacgccatagacatacctgggctggccgggggcaggcag
gccacgggcgaggagaaggtcagggccgtcatggaccttgaggagaggaacgcgatttac
gacagcgcggtgctctgcaagttcggcaggaacgcctacggctggagcgagctggtccag
gtgctcaacgccgtgaccggcttcagctacgaccaggcctcgctgagggagacggcagag
aggataatagttatacacaggtacatgaacgggaccacggtagaggatgacaagctgccg
cccaggtggctcaatgagcccgtggagttcgatggcaagaggtacgtcgtggctgaggag
gagtggaggcgcatggttatgacgtactataagctcaggggctacgacgaggaggggagg
ccaacaagggagacccttgagaggctgggcatacttaaggccgccggcggctga

DBGET integrated database retrieval system