KEGG   Acidilobus saccharovorans: ASAC_0698Help
Entry
ASAC_0698         CDS       T01283                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
asc  Acidilobus saccharovorans
Pathway
asc00030  Pentose phosphate pathway
asc01100  Metabolic pathways
asc01120  Microbial metabolism in diverse environments
asc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:asc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ASAC_0698
Enzymes [BR:asc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     ASAC_0698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ADL19104
UniProt: D9Q1B6
Position
complement(703605..705398)
Genome map
AA seq 597 aa AA seqDB search
MGSFSRLIRVDLGSGEVKYDELRDEDVRAYLGGRGIGLLLALKGGYGRPQDPLSPELPLI
IASGPLSGAGIPLSSRATAVFFSPLSRRWSYSTVGGSLAVIMRYAGADVLMVTGRAQRPS
YIVVEGGRAEVRDASGLWGMGTFDAERALKEVHGQEAAVAVIGPAGENLVPFASINHETW
RQFGRSGGGAVMGSKNLKAVVFVPSGRSIEVADPERTWSMISYMTQRLATAAKSYRDNGT
LGTIDAANGTGFFPSLYWTGVSAPGWRRISWYEVLSKNYYVGKRATCLHCPVACHKVVTS
RRYGGYYELEYETTMALAGLTGVVDPDELIQLASLVDDVGLDTISTGNVLGLLAYLTEKG
YVDPSEGVRFGDAQRFRELITAIAKREGIGKVLSMGTREAARALGHPEVAIEVKGLEPAG
YDPRTLKGMILTYAVAERGADHLWSSGYAIDIPGLAGGRQATGEEKVRAVMDLEERNAIY
DSAVLCKFGRNAYGWSELVQVLNAVTGFSYDQASLRETAERIIVIHRYMNGTTVEDDKLP
PRWLNEPVEFDGKRYVVAEEEWRRMVMTYYKLRGYDEEGRPTRETLERLGILKAAGG
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
ttggggagcttcagcaggctcataagggtcgacctgggcagcggcgaggtgaagtacgac
gagctgagggacgaggacgtgagggcctacctggggggcaggggcataggactcctgctc
gcgcttaaggggggctacggcaggccccaggaccccctctcgccggagctgcccctcata
attgcgtccggccccctctcaggcgccggaatacccctctcgtcgagggccacggccgtg
ttcttctcgccgctgagcaggaggtggagctactccacggtggggggctccctggctgtg
ataatgaggtacgcgggggccgacgtgctaatggtgacgggcagggcccagaggccctca
tacatagtggtcgaggggggcagggccgaggtcagggacgcctcgggcctctggggcatg
gggaccttcgacgccgagagggcgcttaaggaggtccacggccaggaggcggcggtggcg
gtcataggcccggcgggggagaacctggtgccattcgcctccataaatcatgagacgtgg
aggcagttcggcaggtcaggcggaggcgcggtcatgggctcaaagaacctgaaggctgta
gtcttcgtgccgagcggcaggtccatcgaggtcgcggaccccgagaggacctggtcaatg
ataagctacatgacccagaggctcgcgacggcagctaaaagctacagggacaacgggacc
ctgggcaccatagacgcggccaacggcaccggcttcttcccctcgctctactggaccggg
gtgtcggccccgggctggaggaggatctcgtggtacgaggtgctcagcaagaactactac
gtcgggaagagggccacgtgcctccactgccccgtggcctgccacaaggtggtcacctcc
aggaggtacgggggctactacgagctggagtacgagaccacaatggccttggccggcctg
acgggcgtcgtggacccggacgagcttatacagctcgcctccctggttgacgacgtgggg
ctggacaccataagcactggcaacgtgctcggcctgctggcgtacctgacggagaagggc
tacgtggacccatcagagggcgtgaggtttggggacgcgcagcgcttcagggagctcata
acggccatagcaaagagggagggcataggcaaggtgctctccatggggaccagggaggcc
gccagggccctggggcaccccgaggtggccatagaggtcaagggccttgaacctgcgggc
tacgacccgaggacgctgaagggcatgatactgacatatgctgtagcggagaggggcgcg
gaccacctgtggagcagcggctacgccatagacatacctgggctggccgggggcaggcag
gccacgggcgaggagaaggtcagggccgtcatggaccttgaggagaggaacgcgatttac
gacagcgcggtgctctgcaagttcggcaggaacgcctacggctggagcgagctggtccag
gtgctcaacgccgtgaccggcttcagctacgaccaggcctcgctgagggagacggcagag
aggataatagttatacacaggtacatgaacgggaccacggtagaggatgacaagctgccg
cccaggtggctcaatgagcccgtggagttcgatggcaagaggtacgtcgtggctgaggag
gagtggaggcgcatggttatgacgtactataagctcaggggctacgacgaggaggggagg
ccaacaagggagacccttgagaggctgggcatacttaaggccgccggcggctga

DBGET integrated database retrieval system