KEGG   Acidilobus saccharovorans: ASAC_0747Help
Entry
ASAC_0747         CDS       T01283                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain Iphosphomannomutase - sulfolobus solfataricus (EC:5.4.2.10)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
asc  Acidilobus saccharovorans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:asc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASAC_0747
   00030 Pentose phosphate pathway
    ASAC_0747
   00051 Fructose and mannose metabolism
    ASAC_0747
   00052 Galactose metabolism
    ASAC_0747
   00500 Starch and sucrose metabolism
    ASAC_0747
   00520 Amino sugar and nucleotide sugar metabolism
    ASAC_0747
  Nucleotide metabolism
   00230 Purine metabolism
    ASAC_0747
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ASAC_0747
Enzymes [BR:asc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     ASAC_0747
    5.4.2.8  phosphomannomutase
     ASAC_0747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
756141..757529
Genome map
AA seq 462 aa AA seqDB search
MAKLFGTDGVRGVVGDLMTPTFALKMGHAIGAYFGPGSRVLLARDARAAGDALARAVAAG
LMAEGVKVYYAGMVPTPTMQYGVKALGFDGGVMITASHNPREYNGIKVIEHDGVEIPHER
EPIIEDYYFKGHETNLPWRSMVYDVADVSQVVIDTYVKAVVSQVDSDLIAKKGFTVLVDC
ANSVGAVTTPLILRELGVRAITVNCNLDPGFPGRNPEPNEENLALTLRFVREAGVNMGVA
HDGDADRAILIDERGRLIWGDRAGALLTRFVVESGRWKGLPMRTYTAVSSSQLVEEYLRP
TGVEVRWTPVGSVTIARTILSEGGAISGFEDNGGYMHVPHHTVRDGGMTTALALYMLALE
GRSLGELYDSLPQYYAIKTKVEATREQALCGVEAVKEAFSGYRQITIDGVKVIGDDFWVL
VRPSGTEPIMRISVEARTRERAEAIVKQVEDLYRSRCGGAGK
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
ttggctaagctgtttggcactgacggcgtcaggggggttgtcggggacctcatgactccc
accttcgcactgaagatggggcacgccataggcgcctacttcggccccgggtccagggtg
ctgctggccagggacgccagggcagctggggacgccctggccagggcggttgccgcgggg
ctcatggctgagggggtaaaggtgtattacgccggcatggtgcccacccccacaatgcag
tacggggtcaaggccctgggctttgacgggggcgtcatgataacagccagccacaacccg
agggagtacaacggaataaaggtgattgagcacgacggcgttgagataccccacgagagg
gagcccataatagaggactactacttcaagggccacgagaccaacctgccgtggaggtca
atggtatatgacgtcgccgacgtgagccaggtggtcatagacacgtacgttaaggcggtc
gtctcccaggtcgacagcgaccttatagcgaagaaggggttcacggtcctagtggactgc
gccaacagcgtcggcgccgtcacgacccccctgatactcagggagctgggggttagggcc
ataactgtgaactgcaacctcgaccccggcttcccggggaggaacccggagcccaacgag
gagaaccttgccctcacgctcaggttcgtgagggaggcgggcgtcaacatgggtgttgcc
cacgacggcgacgccgacagggccatactgatagacgagagggggaggctcatatggggc
gacagggcaggcgccctgctgactcgcttcgttgttgagagcggcaggtggaagggcctg
cccatgaggacctacaccgccgtctcgagcagccagctggtcgaggagtacctgaggccg
acgggcgttgaggtcaggtggacgcccgtgggcagcgtcaccatagcgaggacaatatta
agcgagggaggggccataagcggcttcgaggacaacggcggctacatgcacgtgccacat
cacaccgtcagggacgggggcatgaccacagcccttgccctctacatgcttgccctcgag
ggcaggagcctcggggagctctacgactcgctgccccagtactacgccataaagaccaag
gtggaggccaccagggagcaggcgctgtgcggcgtcgaggccgtcaaggaggccttctcg
ggctacaggcagataaccatagacggggtcaaggtgataggcgacgacttctgggtcctc
gtgaggcccagcgggaccgagccaataatgaggatatcggtggaggccaggacaagggag
agggcggaggccatagttaagcaggtcgaggacctgtaccgctccaggtgcgggggagcc
gggaagtga

DBGET integrated database retrieval system