KEGG   Acidilobus saccharovorans: ASAC_0762Help
Entry
ASAC_0762         CDS       T01283                                 

Definition
Aldehyde:ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
asc  Acidilobus saccharovorans
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:asc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ASAC_0762
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ASAC_0762
Enzymes [BR:asc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     ASAC_0762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
772854..774842
Genome map
AA seq 662 aa AA seqDB search
MDRPYRPELHFIRLGLPDRLGLAVKWYGYKGRILRVDLSAGKTSVEELRLDYVKMYMGGL
GYAAKVLWDELQPGVDPLSPDNILIATAGPFTGTLAPGSGNIYWAFKAPMTGGWGETRSG
GKFGSWMKYSGFDLIVIRGRAPEPVYLYLESGRAEIRSAKRYWGMTVHEVTDALRDDTGV
HEASVAAIGPAGENLVRFAAIINDYDRAAGRTGGGAVMGSKNLKAVVAAGGEGIDVYDPE
GFMAAALEAQGGIKADPGQRFMGQHGTIGGLLGTNAMGGLPTANFETGYFEAADRVSHET
LERNYMIKRRACHACAIGCSRYSYVAYGPFATPPNEGPEYETADMNGPMNMIDNMEAIIR
VNYLANNYGLDTISTGHTIAWAIEAYQKGIITKQDTGGLELRWNDPETHVKLVEMIAYRK
GFGNLLAEGSYRAAKAIGRGAEELVNHVKGLEFPAHDPRVESKLLAIQYAISPRGACHVH
PIYPSYDMMQVDAGLKDFGLPWPLPDRLAETGVGKGIAYRALASYGEAFNNVGLCIFYSA
GPESGVISPRRIARIYTALTGIETTPQDVLLAGERTWNLKRAFNLREGFTREHDRLPKRM
ITPILTGPAKGLKVESPDGLVDEAYDAFGWDRRTGYIRRSTLERLGMKDVEEQLQKLGKL
SD
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggataggccttacaggcctgagctccactttatacggcttggcctccccgacaggctg
ggacttgctgtgaagtggtacggctacaagggccgcatcctgagggttgacctctccgct
ggcaagaccagcgtggaggagctaaggctggactacgtcaagatgtacatgggaggcctc
ggctacgccgccaaggtgctctgggatgagcttcagccgggggtagacccgctgtcgccc
gacaacattctcatagccaccgccggccccttcacggggaccctggccccgggcagcggc
aacatatactgggccttcaaggcccccatgacgggcggctggggggagacgaggtcaggg
ggcaagttcggctcgtggatgaagtacagcggctttgacctaatagtcataaggggcagg
gcccccgagcccgtctacctgtaccttgagtcaggcagggctgagataaggagcgcaaag
aggtactggggcatgacagtacatgaggtcactgacgccctcagggatgacacaggggtt
cacgaagcctcggtggccgccataggcccggctggggagaacctggtcagattcgccgcc
ataataaacgactatgacagggcggccggcaggacgggcggaggggcggtcatgggctcg
aagaacctcaaggccgtggtggcggccggcggcgaggggatagacgtctacgacccggag
ggcttcatggctgccgcgctcgaggcccagggaggcataaaggccgacccaggccagagg
ttcatgggacagcacggcaccataggcgggctcctgggaaccaacgccatgggagggctc
cccacggcgaactttgagactggctactttgaggcggccgacagggtgtcgcacgagacg
ctcgagaggaactacatgataaagaggagggcgtgccacgcctgcgcaatagggtgcagc
aggtacagctacgtcgcctacggccccttcgccaccccgcccaacgagggccccgagtac
gagactgccgacatgaacggccccatgaacatgatagacaacatggaggccataataagg
gtcaactacctcgccaacaactacggcctggacaccatatcaacggggcacacgatagcg
tgggccatagaggcgtaccagaaggggataataacgaagcaggacaccggcggccttgag
ctgaggtggaacgaccccgagacacacgtgaagcttgtcgagatgatagcctacaggaag
ggcttcgggaacctgctggcggaggggagctacagggccgccaaggccataggcaggggc
gccgaggagctggtgaaccatgtcaagggcctcgagttccccgcccacgaccccagggtc
gagtccaagctgttggccatacagtatgcaataagcccgaggggcgcctgccacgtgcac
ccaatatacccgtcgtacgacatgatgcaggtggacgccggcctcaaggacttcggcctc
ccgtggccgctgcctgacaggctcgccgagacgggagtcggcaaggggatagcctacagg
gcgctggccagctacggggaggctttcaacaacgtgggcctctgcatattctactcggcg
gggcccgagagcggggtcataagtccaaggaggatagccaggatatacacagcgctgaca
ggcatagagaccaccccccaggacgtgctgttggccggcgagaggacgtggaacctgaag
agggccttcaacctcagggaggggttcaccagggagcacgacaggctgcccaagaggatg
ataacgcctatactcacggggcccgccaaggggctcaaggttgagagcccagacggcctt
gtagatgaggcctacgatgcctttgggtgggacaggaggactggctacataaggaggtca
acgcttgaaaggcttggcatgaaggacgttgaggagcagctccagaagctcggcaaattg
tctgactga

DBGET integrated database retrieval system