KEGG   Acidilobus saccharovorans: ASAC_0764Help
Entry
ASAC_0764         CDS       T01283                                 

Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
asc  Acidilobus saccharovorans
Pathway
asc00260  Glycine, serine and threonine metabolism
asc01100  Metabolic pathways
asc01110  Biosynthesis of secondary metabolites
asc01120  Microbial metabolism in diverse environments
asc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:asc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ASAC_0764
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ASAC_0764
Enzymes [BR:asc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ASAC_0764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Adenine_deam_C zf-ribbon_3 HypA TF_Zn_Ribbon zinc_ribbon_2 OrfB_Zn_ribbon NRDD
Motif
Other DBs
NCBI-ProteinID: ADL19170
UniProt: D9Q1I2
Position
complement(775294..776292)
Genome map
AA seq 332 aa AA seqDB search
MAWRLVCPRCGFRGEEGRYYHRCPRCGSPLEFEGERPRYGRLLGEGSTPLVYRETPLGPI
GFKLEYVNPTGSFKDRGTAYSLQLARDLGYRCVVEDSSGNAGISTAAYASFLGLEAVVAV
PRTAAPSKKSIIASLGARVVELDSREEAAKYAEAMAGRCFYVAHSVSAAFLEGMTSAGRE
VPEGSAVVVPSASFSLFLGIWRGSGGKVRLYAVQGVQNATLRGLVEPIAVGSGSTSSLAD
GLVLPSAPRAQEAADAIRRSGGGLVLVSDKEIAEATRDLWSMGLMAEPTSASAYAALKLL
REVGVDVGGFIAVLTGSGLKFYDLVSRIRTLT
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
ttggcctggaggctcgtgtgccccaggtgcggcttcaggggcgaggagggcaggtactac
cacaggtgccccaggtgcggctcgccgctggagtttgagggggagaggccgaggtacggg
aggctcctcggcgagggctcaaccccccttgtctacagggagacgccgctcggccccata
ggcttcaagctggagtacgtcaacccgacgggcagcttcaaggacaggggcacggcctac
tcgcttcagctcgccagggacctcggctacaggtgcgtggtcgaggactcgagcggcaac
gcgggcatctccacggccgcctacgcctcgttccttgggctggaggccgtagtggcggtg
cccaggacggcggccccctccaagaagtcaataatagcgtcgctgggggccagggtggtc
gagctcgacagcagggaggaggcggccaagtacgcggaggccatggctggcaggtgcttc
tacgtggcccactctgtgagcgccgccttccttgaggggatgacctcagctggcagggag
gtgccagagggctccgccgtggtggtcccctcggccagcttctcgctgttccttggcatc
tggaggggctcagggggcaaggtcaggctgtacgccgtgcagggggtgcagaacgccacc
ctcaggggcctcgtggagcccatagccgttggctccggcagcacgtcgtccctggccgac
ggcctggtgctcccctcggcgccgagggcccaggaggccgctgatgccataaggaggagc
gggggaggcctggtgctggtctcggacaaggagatagcggaggccaccagggacctctgg
tccatggggctcatggctgagcccacctcggcctcggcatatgcagccctgaagctcctg
agggaggtgggcgttgacgtgggcgggttcatagccgtgctcacgggcagcgggctgaag
ttctacgacctggtctctaggatccgcaccttgacctga

DBGET integrated database retrieval system