KEGG   Acidilobus saccharovorans: ASAC_0764Help
Entry
ASAC_0764         CDS       T01283                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
asc  Acidilobus saccharovorans
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:asc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ASAC_0764
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ASAC_0764
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ASAC_0764
Enzymes [BR:asc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ASAC_0764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(775294..776292)
Genome map
AA seq 332 aa AA seqDB search
MAWRLVCPRCGFRGEEGRYYHRCPRCGSPLEFEGERPRYGRLLGEGSTPLVYRETPLGPI
GFKLEYVNPTGSFKDRGTAYSLQLARDLGYRCVVEDSSGNAGISTAAYASFLGLEAVVAV
PRTAAPSKKSIIASLGARVVELDSREEAAKYAEAMAGRCFYVAHSVSAAFLEGMTSAGRE
VPEGSAVVVPSASFSLFLGIWRGSGGKVRLYAVQGVQNATLRGLVEPIAVGSGSTSSLAD
GLVLPSAPRAQEAADAIRRSGGGLVLVSDKEIAEATRDLWSMGLMAEPTSASAYAALKLL
REVGVDVGGFIAVLTGSGLKFYDLVSRIRTLT
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
ttggcctggaggctcgtgtgccccaggtgcggcttcaggggcgaggagggcaggtactac
cacaggtgccccaggtgcggctcgccgctggagtttgagggggagaggccgaggtacggg
aggctcctcggcgagggctcaaccccccttgtctacagggagacgccgctcggccccata
ggcttcaagctggagtacgtcaacccgacgggcagcttcaaggacaggggcacggcctac
tcgcttcagctcgccagggacctcggctacaggtgcgtggtcgaggactcgagcggcaac
gcgggcatctccacggccgcctacgcctcgttccttgggctggaggccgtagtggcggtg
cccaggacggcggccccctccaagaagtcaataatagcgtcgctgggggccagggtggtc
gagctcgacagcagggaggaggcggccaagtacgcggaggccatggctggcaggtgcttc
tacgtggcccactctgtgagcgccgccttccttgaggggatgacctcagctggcagggag
gtgccagagggctccgccgtggtggtcccctcggccagcttctcgctgttccttggcatc
tggaggggctcagggggcaaggtcaggctgtacgccgtgcagggggtgcagaacgccacc
ctcaggggcctcgtggagcccatagccgttggctccggcagcacgtcgtccctggccgac
ggcctggtgctcccctcggcgccgagggcccaggaggccgctgatgccataaggaggagc
gggggaggcctggtgctggtctcggacaaggagatagcggaggccaccagggacctctgg
tccatggggctcatggctgagcccacctcggcctcggcatatgcagccctgaagctcctg
agggaggtgggcgttgacgtgggcgggttcatagccgtgctcacgggcagcgggctgaag
ttctacgacctggtctctaggatccgcaccttgacctga

DBGET integrated database retrieval system