KEGG   Acidilobus saccharovorans: ASAC_0878Help
Entry
ASAC_0878         CDS       T01283                                 

Definition
ADP-dependent hexokinase (HK) (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
asc  Acidilobus saccharovorans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:asc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ASAC_0878
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASAC_0878
   00052 Galactose metabolism
    ASAC_0878
   00500 Starch and sucrose metabolism
    ASAC_0878
   00520 Amino sugar and nucleotide sugar metabolism
    ASAC_0878
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ASAC_0878
   00524 Butirosin and neomycin biosynthesis
    ASAC_0878
Enzymes [BR:asc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ASAC_0878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(890540..891526)
Genome map
AA seq 328 aa AA seqDB search
MWAGEPMGRIIAVDIGATNLRVALFEGERPVAVRKTQTPRTSGSDLVKAIVDLVRDVSGG
YDFEAIGVASIGPLDLRNGTLLWAPNLGYGNVNIRDSLGSEFQRPVYLTNDALAGAWAEK
VLGAGKELEDLAYVTMSTGLGVGAVVDGNLIVGRRGNAHELGHSIVDFESELRCGCGGNG
HWEAYVGGRNIPRTAQYLTSRWSGPRTKAFELASRGELSPEALYSMARQGDEFARYAVSF
INRVHAAGMMNIIAAYDPEAIFIGGSIYLYNEDLIKGELIEFMKEYVGVFGVPRIERCTF
GDDEVLYGAAATAINPPQAIARSAYRPR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
ttgtgggccggggagcctatgggaaggataatagccgttgacataggcgctaccaacctg
agggttgccctgtttgagggcgaaaggcccgtcgctgtaaggaagacgcagacgcctagg
accagcggcagcgacctagttaaggcgatagtagacctggtaagggacgtgagtgggggc
tacgactttgaggccataggagtggcctccataggcccccttgacctaaggaatgggacc
ctgctctgggcccccaacctgggctatggtaacgttaacataagggactccctgggcagc
gagttccagaggccggtctacctcaccaacgacgcgctggcaggcgcctgggctgagaag
gtcctgggggctggcaaggagctcgaggacctggcctacgtcactatgagcacgggcctt
ggagtaggcgctgtagttgatggtaacctcatagttggaaggaggggcaacgcgcacgag
ctgggacatagcatagttgacttcgagtccgagctcaggtgcggctgcgggggcaacggc
cactgggaggcctacgtgggagggaggaacatacccaggacggcccagtacctaacgtcc
aggtggtcagggcctcgcactaaggccttcgagctcgcctccaggggcgagctcagccca
gaggccctctactcaatggccaggcagggcgacgagttcgcgcgctacgcggtgagcttc
ataaacagggtccacgcggccggcatgatgaatataatcgccgcctacgaccccgaggcc
atattcatagggggcagcatatacctgtacaacgaggacctgataaagggcgagctaata
gagttcatgaaggagtacgtgggcgtcttcggcgtgcctagaatagagaggtgcacgttt
ggggacgacgaggtgctttacggtgccgcggccacagcgataaatccgccgcaggccata
gctaggagcgcctacaggccaaggtag

DBGET integrated database retrieval system