KEGG   Acidilobus saccharovorans: ASAC_0892Help
Entry
ASAC_0892         CDS       T01283                                 

Definition
(GenBank) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
asc  Acidilobus saccharovorans
Pathway
asc00010  Glycolysis / Gluconeogenesis
asc01100  Metabolic pathways
asc01110  Biosynthesis of secondary metabolites
asc01120  Microbial metabolism in diverse environments
asc01130  Biosynthesis of antibiotics
asc01200  Carbon metabolism
asc01230  Biosynthesis of amino acids
Module
asc_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:asc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASAC_0892
Enzymes [BR:asc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     ASAC_0892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N GFO_IDH_MocA Semialdhyde_dh Sacchrp_dh_NADP 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ADL19298
UniProt: D9Q1W0
Position
902948..903994
Genome map
AA seq 348 aa AA seqDB search
MAVRGKVAVGVNGYGTIGRRVAWAAGLQPDMELVGVVKTKPDYAAAQAMSAGIPVYVPGE
AEAERFRKAGLEVSGTIRDLLREVDVIVDATPDGVGATYSKLYREAGVKAIFQGGEEASV
AQVSFSALCNYDEAVGKDSARVVSCNTTGLLRSICAINSAVGVRAVNAFLVRRAADMHEV
KRGPINSVVLNPPRVPSHHAGDVRTVLPWLDITTAAVVVPTTLMHVHYVTMKLKGNASRE
EVLDALRSSPRVLVVSASKSGVEGTSQIIDAARHIRPRGDVPELVVFEESVLSKGDEVSF
IQAVHQESIVVPENVDAIRALTGLSDGEQSVKLTNYALGIGKLPGLSL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtggccgtgaggggcaaggtcgccgtaggggtaaacggctatggaaccataggcaggagg
gtggcctgggcggcgggcctccagcctgacatggagctagttggcgtggttaagacaaaa
cctgactacgcggccgcccaggccatgagcgctgggataccggtctacgtgccaggggag
gccgaggccgagaggttcaggaaggcaggccttgaggtcagcggcaccataagggacctg
ctgagggaggttgacgtcatagttgacgcgaccccggacggcgttggggccacctactct
aagctctacagggaggccggcgtcaaggcaattttccaggggggcgaggaggcctcggtg
gcccaggtttcgttcagcgcgctgtgcaactacgatgaggccgtaggcaaggacagcgcc
agggtggtctcgtgcaacacgacggggctcctgaggtccatatgcgcgatcaactcggcc
gtgggtgtcagggcggtcaacgcgttcctagttaggagggcggccgacatgcacgaggtc
aagaggggtcccataaactcagttgtgctcaacccgcccagggtccccagccaccacgcg
ggcgacgtgaggaccgtgctcccctggctcgacataactacggccgccgtggtggtgccc
accaccctaatgcacgtccactacgtgacgatgaagcttaaggggaacgcctcaagggag
gaggttctcgacgccctgaggtcgtcgccgagggtactggtggtcagcgcctcaaagtcc
ggcgtggagggcacctcccagatcattgatgcagctaggcacattaggcccaggggtgac
gtgcctgagctcgtggtgtttgaggagagcgtcctatccaagggagacgaggtgtccttc
atacaggccgtccaccaggagtccatagtggtaccagaaaacgtagatgccataagggcg
ctcacaggcctcagcgacggcgagcagtcagttaagctgaccaactatgccctgggcatc
ggaaagctgccggggctctctctttga

DBGET integrated database retrieval system