KEGG   Acidilobus saccharovorans: ASAC_0898Help
Entry
ASAC_0898         CDS       T01283                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
asc  Acidilobus saccharovorans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ASAC_0898
Enzymes [BR:asc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     ASAC_0898
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
907974..909449
Genome map
AA seq 491 aa AA seqDB search
MERGSGLLLHITSLPGSPLVGDLGPSAHEFLEILRDAGQRYWQVLPLSPTAPEHDNSPYS
GLSAFAGNPIMVSPQLLANEGLLAADELASLPRGEPNRVDYGLAYEHRMRLLRLAFSRFK
PSGDYDRFLDRNSWWLEDYALYVSLREHFKGSDWSSWPEGLRRRDRGEMQAWREKLKERI
ELEHFIQYEFFSQWSSLRAHARRLGIRIIGDIPIYVSYDSADVWSNPRIFKLGRDLRPTY
VSGVPPDYFSRTGQLWNTPVYDWESLRRERYSWWIRRFAHASELFDAVRLDHFRGFAAYW
EVPAGEKTAVNGRWARGPGEDLFRRVMREVPRLQLIAEDLGFITPDVVQLRDRLGLPGLK
VLQFAWDGNPGNPYKPHNYGRNFVVYTGTHDNNTIVGWFFHEASPRARREAMNYMGLRDA
REINWAFIRLAMMSVADVSIFPVQDVLGLGPEARMNTPGTVGNNWRWRLESFDGLRRAAR
RLRDMTRAYGR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaggggaagcggcctactgctgcacataacttccctcccaggctcccctttggta
ggcgacctgggcccctcagcccatgagttcctcgaaatactcagggatgcagggcagagg
tactggcaggtgctgcccctgagccccactgcccctgagcacgacaactcgccctacagc
ggactctcagcgttcgctggaaaccccataatggtgagcccccagctgctggcaaacgag
gggctcctcgcggctgatgagctcgcctccctcccacggggagagccgaacagggtggac
tacgggcttgcgtatgagcacaggatgaggctcctaaggctggccttctcaaggtttaag
cccagcggcgactacgacaggttccttgacaggaactcctggtggcttgaggactacgcg
ctttacgtctcgctgagggagcacttcaagggctccgactggtcctcgtggcccgagggc
cttaggcgcagggataggggtgagatgcaggcctggcgcgagaagctgaaggagaggatt
gagcttgagcacttcatccagtacgagttcttctcgcagtggtcctcgctcagggctcac
gcgaggaggctcggcataaggataataggtgacataccgatttacgtgagctatgacagc
gctgacgtgtggtccaaccccaggatattcaagctgggccgtgacctcaggccaacctac
gtctccggggtgccgcccgactacttcagcaggacggggcagctgtggaacacgcccgtc
tatgactgggagtcgcttaggagggagaggtactcctggtggataaggaggttcgcccac
gcctcggagttattcgacgccgtcaggcttgaccacttcaggggcttcgccgcctactgg
gaggtgccggcgggcgagaagaccgccgtcaacggcaggtgggccaggggtcccggggag
gacctcttcaggcgggttatgagggaggtgccgaggctccagctcatagctgaggacctg
gggttcataacgcctgacgtggtgcagctcagggacaggcttggcctccctggcctcaag
gtgctgcagttcgcctgggacggcaacccaggcaacccgtacaagccgcacaactacggc
aggaacttcgttgtttacacgggcacccacgacaacaacacaatagttggctggttcttc
cacgaggcctcccccagggcgaggcgcgaggcaatgaactacatggggctcagggatgcc
agggagataaactgggccttcataaggctcgccatgatgagcgtggcagacgtgtccatc
ttcccagtccaggacgtgctcggcctgggccctgaggccagaatgaacacgccgggcact
gttggcaacaactggaggtggaggcttgaatcgtttgatgggctcaggagggccgcgaga
aggctcagggacatgacaagggcctacgggcgttag

DBGET integrated database retrieval system