KEGG   Acidilobus saccharovorans: ASAC_0931Help
Entry
ASAC_0931         CDS       T01283                                 

Definition
acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
asc  Acidilobus saccharovorans
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:asc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ASAC_0931
  Amino acid metabolism
   00300 Lysine biosynthesis
    ASAC_0931
Enzymes [BR:asc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     ASAC_0931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
941701..942987
Genome map
AA seq 428 aa AA seqDB search
MNVESLSMRLAKLTSDMIRIDTSNPPGHTREFVNFLVDYLQLQGFSPDTVEIAEGKPNLI
VKVGSGSPTLILNGHMDVVPAGDKGKWTKADPFSGEIKDDKVYGRGATDMKGGLAVIVAL
FSDVAKLIEDRGAGSLTLVASADEEVGGANGLGALVSRKVVTGDAAIIAEPSGVETISIG
EKGLCQISLTVKGRSAHGSMPILGDNAITKSLDVIELLSQAIDSYNSKIEPPKDLEEMLE
SSIDVLVEEASKSQVKISRSEAEYVLKKITFNPGVMHCGTKINVVPDRCDVEIDTRLPLG
VKGGGERTACELLLEDIRSILLENLPPDSFELGILNSSEPNYTDPNSGIVKVISNSIERV
LGVKPKYRIETGATDGRYLRYVGVPVAIYGPGEPFLAHAYNEYVKIEDLEKAYKVLRDAV
LSFFNVSE
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtagaaagccttagcatgaggttagcgaagctaacctctgacatgataagaatt
gacacctccaaccctcctggccacacgagggagttcgtgaacttccttgtagactacctg
cagcttcagggcttcagccctgatactgttgagatagctgaaggcaagccaaacctaata
gttaaggttggctcggggtcgccgacgctgatactcaacggccacatggacgtggtgcct
gctggcgacaaggggaagtggaccaaggccgaccccttctccggggagatcaaggacgac
aaggtttacgggaggggcgccactgacatgaagggcggactggctgtaatagtagcacta
ttctctgatgtggcaaaacttatagaggacaggggagcgggctcccttacgttagtggcc
agcgctgacgaagaggttggaggcgccaatggactgggggccctcgtctccagaaaagtt
gtcacgggggacgcagcgataatagctgagccgtcaggcgtcgagacgatctccatagga
gagaaggggctctgtcaaatatcgctgacagttaagggcaggtccgcccatggtagcatg
cccatccttggcgataacgccataacaaagtcgcttgacgtcatagagctgctttcacag
gccatagactcctacaattctaagatagagccgcctaaggatcttgaggaaatgcttgag
agctctatagacgtcctggttgaggaggccagcaagtcacaagttaagatatcaaggagc
gaggcggagtacgtgcttaagaagataaccttcaacccaggcgtcatgcactgcggcaca
aagatcaatgtagtgcccgacaggtgtgacgttgaaatagatacaaggctgccgcttggg
gtcaagggcggcggcgagcgcacggcctgtgagctcctgctcgaggacataagaagcata
ctcctggaaaacctgccgcctgacagctttgagctcggaattcttaacagcagcgagcct
aactacacggatcctaacagcggcatagttaaggtaatctctaattctattgaaagggtc
cttggcgttaagcctaagtaccgcatagagacaggcgccaccgacggccgctatttgagg
tatgtcggcgtgcctgtggcgatctacggccctggcgagccgttcttagcgcacgcctat
aatgaatacgtaaagatcgaagatttagagaaggcctataaggtcctcagggatgccgtg
ctatcatttttcaacgtgagcgagtga

DBGET integrated database retrieval system