KEGG   Acidilobus saccharovorans: ASAC_0931Help
Entry
ASAC_0931         CDS       T01283                                 

Definition
(GenBank) acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
asc  Acidilobus saccharovorans
Pathway
asc00300  Lysine biosynthesis
asc01100  Metabolic pathways
asc01120  Microbial metabolism in diverse environments
asc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:asc00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    ASAC_0931
Enzymes [BR:asc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     ASAC_0931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer GP70 Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ADL19336
UniProt: D9Q1Z8
Position
941701..942987
Genome map
AA seq 428 aa AA seqDB search
MNVESLSMRLAKLTSDMIRIDTSNPPGHTREFVNFLVDYLQLQGFSPDTVEIAEGKPNLI
VKVGSGSPTLILNGHMDVVPAGDKGKWTKADPFSGEIKDDKVYGRGATDMKGGLAVIVAL
FSDVAKLIEDRGAGSLTLVASADEEVGGANGLGALVSRKVVTGDAAIIAEPSGVETISIG
EKGLCQISLTVKGRSAHGSMPILGDNAITKSLDVIELLSQAIDSYNSKIEPPKDLEEMLE
SSIDVLVEEASKSQVKISRSEAEYVLKKITFNPGVMHCGTKINVVPDRCDVEIDTRLPLG
VKGGGERTACELLLEDIRSILLENLPPDSFELGILNSSEPNYTDPNSGIVKVISNSIERV
LGVKPKYRIETGATDGRYLRYVGVPVAIYGPGEPFLAHAYNEYVKIEDLEKAYKVLRDAV
LSFFNVSE
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtagaaagccttagcatgaggttagcgaagctaacctctgacatgataagaatt
gacacctccaaccctcctggccacacgagggagttcgtgaacttccttgtagactacctg
cagcttcagggcttcagccctgatactgttgagatagctgaaggcaagccaaacctaata
gttaaggttggctcggggtcgccgacgctgatactcaacggccacatggacgtggtgcct
gctggcgacaaggggaagtggaccaaggccgaccccttctccggggagatcaaggacgac
aaggtttacgggaggggcgccactgacatgaagggcggactggctgtaatagtagcacta
ttctctgatgtggcaaaacttatagaggacaggggagcgggctcccttacgttagtggcc
agcgctgacgaagaggttggaggcgccaatggactgggggccctcgtctccagaaaagtt
gtcacgggggacgcagcgataatagctgagccgtcaggcgtcgagacgatctccatagga
gagaaggggctctgtcaaatatcgctgacagttaagggcaggtccgcccatggtagcatg
cccatccttggcgataacgccataacaaagtcgcttgacgtcatagagctgctttcacag
gccatagactcctacaattctaagatagagccgcctaaggatcttgaggaaatgcttgag
agctctatagacgtcctggttgaggaggccagcaagtcacaagttaagatatcaaggagc
gaggcggagtacgtgcttaagaagataaccttcaacccaggcgtcatgcactgcggcaca
aagatcaatgtagtgcccgacaggtgtgacgttgaaatagatacaaggctgccgcttggg
gtcaagggcggcggcgagcgcacggcctgtgagctcctgctcgaggacataagaagcata
ctcctggaaaacctgccgcctgacagctttgagctcggaattcttaacagcagcgagcct
aactacacggatcctaacagcggcatagttaaggtaatctctaattctattgaaagggtc
cttggcgttaagcctaagtaccgcatagagacaggcgccaccgacggccgctatttgagg
tatgtcggcgtgcctgtggcgatctacggccctggcgagccgttcttagcgcacgcctat
aatgaatacgtaaagatcgaagatttagagaaggcctataaggtcctcagggatgccgtg
ctatcatttttcaacgtgagcgagtga

DBGET integrated database retrieval system