KEGG   Acidilobus saccharovorans: ASAC_0970Help
Entry
ASAC_0970         CDS       T01283                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
asc  Acidilobus saccharovorans
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ASAC_0970
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ASAC_0970
Enzymes [BR:asc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     ASAC_0970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(975842..976786)
Genome map
AA seq 314 aa AA seqDB search
MGILPWRGRDVIDPRDFTREDLEILFEEADKMRRQLSSGRVTRTLEGKIIATAFFEPSTR
TRLSFEAAAKRLGADVIGFSAEEATSVAKGESFVDTIRMLDGYADLIVIRHKYEGAAALA
AEVARVPVINGGDGSQHHPTQAMLDLYTVRELFGSVDGLNYLIVGDLKYARTVASLLRAL
SLFKPASVMLSAPPQLQLRDEVRRDVESRGLRLEYVKLEEGLSRADVIYVTRIQRERFPD
PQEYEKVRGSYRITRRLLEAYAKGSAKVLHPLPRVDELAADVDSTSYQAYFLQASLGVPL
RMALLNLILGGEAS
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtgggcattttgccctggcgcggtcgtgacgtaatagacccaagggacttcacaagggag
gacctggagattctttttgaggaggctgacaagatgcgtcgtcagctctcctctggcaga
gtgactagaaccctcgaagggaaaataatagccacggcgttctttgagccatctactaga
acgaggctcagcttcgaagcggcagccaagaggcttggagctgacgttataggcttctcc
gccgaggaggctaccagcgtagccaaaggagaaagctttgttgacaccattaggatgttg
gatggctacgcagacctaatagtgattaggcacaaatatgaaggcgcggctgctctagcc
gccgaggttgcaagggttccagtaattaacggaggtgatggaagccagcaccacccaact
caggccatgttagatctttataccgtgagggagctcttcgggagcgttgatggccttaac
tacctcatagtaggagacctcaagtatgcaaggactgtcgcaagcctcctgagggcactt
tccctgtttaagccagcctcagttatgttgtcagcgccgccacagcttcagctaagggat
gaggtaaggagggacgttgagtccagggggctgaggcttgagtacgttaagcttgaggag
ggactttccagggcggacgtgatatatgttacgagaatacagagggagaggttcccagat
cctcaggagtatgagaaggtccgcggcagctatagaattacaaggaggctactggaggcc
tacgctaagggcagcgccaaggtgttgcaccccctgcctagggttgacgagctggcagct
gatgtggatagcactagctaccaggcctacttcctgcaggcaagccttggagtgcccctt
aggatggctctccttaacctgatcttagggggtgaagcaagttga

DBGET integrated database retrieval system