KEGG   Acidilobus saccharovorans: ASAC_1054Help
Entry
ASAC_1054         CDS       T01283                                 

Definition
(GenBank) 2-Ketoisovalerate:ferredoxin oxidoreductase (VOR), alpha subunit
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
asc  Acidilobus saccharovorans
Pathway
asc00010  Glycolysis / Gluconeogenesis
asc00020  Citrate cycle (TCA cycle)
asc00620  Pyruvate metabolism
asc00640  Propanoate metabolism
asc00650  Butanoate metabolism
asc00680  Methane metabolism
asc00720  Carbon fixation pathways in prokaryotes
asc01100  Metabolic pathways
asc01120  Microbial metabolism in diverse environments
asc01130  Biosynthesis of antibiotics
asc01200  Carbon metabolism
Module
asc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:asc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASAC_1054
   00020 Citrate cycle (TCA cycle)
    ASAC_1054
   00620 Pyruvate metabolism
    ASAC_1054
   00640 Propanoate metabolism
    ASAC_1054
   00650 Butanoate metabolism
    ASAC_1054
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    ASAC_1054
   00680 Methane metabolism
    ASAC_1054
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    ASAC_1054
Enzymes [BR:asc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     ASAC_1054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: ADL19459
UniProt: D9Q2C1
Position
complement(1055186..1056388)
Genome map
AA seq 400 aa AA seqDB search
MTMKALTGNHAVSEAVKLARVEVIAAYPITPQTTMVEKLAEMVDKGELEAKMIRVESEHS
ALAATLGAAAAGARAFTATSSHGLLYMHEVLWWTAGARIPVVMAVAARAIGPPWNIHVEH
SDVMDQRDTGWIISVAQENQEAFDLTLQAFRISEDPRVYLPMIVTLDGFILSHTVAPVDI
PSQEEVDNWLPPRRQPYVITPESNVVMGNIASDEDYFMMRYSIQAAMKAAKQVISEVDLE
YGKAFGRSYGGLVECYRCDDADYVIVITGSWAGDAKKAADMLRDKGVRAGVARIRFVRPW
PEEDLRDKLSNKKGVIVFDRSVSFGSYGQLFSDTAATLYGTKVSMRGVIAGLGGVDVRPD
DIMSEVMDFVGRVEEVGLVYEPQRWMLPKKYAQVGKEVGL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgaaagctctgacaggcaaccatgcggtctctgaagctgtgaagctggctagg
gtcgaggtaatagcggcttacccgataactcctcagacaaccatggttgagaagctcgcc
gagatggtggacaaaggcgagcttgaggctaagatgataagggtggagagcgagcacagc
gccctagcagccaccctaggagcggcggcagcaggggccagggctttcacggcaacttca
agtcatgggctcctgtatatgcatgaggtgctctggtggaccgcaggggccaggataccg
gtcgttatggctgtggcggccagggccatagggccgccgtggaacatccacgttgagcac
agcgacgtcatggatcagagggacaccgggtggataatatctgtggcccaggagaaccag
gaggcgtttgacctgacgctgcaggccttcaggataagcgaggaccccagggtatacctt
cccatgatcgtcacacttgacggcttcatattatcccacacagtggcccccgtagacata
ccttcacaggaggaggtcgacaactggttgccgccgaggaggcagccctacgtgatcacg
cctgagagcaacgtggtaatgggcaacatagcgtcggacgaggactacttcatgatgagg
tactccatacaggcggccatgaaggcggccaagcaggttataagtgaggttgaccttgag
tatggaaaggcctttggaaggtcttacggcggactggtggagtgctaccgctgcgacgac
gcggattacgtgatagtaataacgggcagctgggccggcgacgctaagaaggccgctgat
atgttgagggacaagggagttagggcgggcgtcgcgaggatcaggtttgtcaggccatgg
cctgaggaggacctcagggataagctatccaacaagaagggggtaatagtgtttgacagg
agcgtctcatttggaagctatgggcagctcttcagcgacacggcggcaacgctgtacgga
accaaggtgtccatgagaggcgtcatagcgggacttggaggcgtcgacgtgaggcctgat
gacataatgtctgaggttatggatttcgtaggcagggttgaggaggtgggcctcgtgtat
gaaccgcagaggtggatgctgcctaagaagtatgcccaggtaggtaaggaggtgggcctc
tga

DBGET integrated database retrieval system