KEGG   Acidilobus saccharovorans: ASAC_1054Help
Entry
ASAC_1054         CDS       T01283                                 

Definition
2-ketoisovalerate ferredoxin oxidoreductase subunit alpha (EC:1.2.7.1)
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
asc  Acidilobus saccharovorans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:asc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ASAC_1054
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASAC_1054
   00020 Citrate cycle (TCA cycle)
    ASAC_1054
   00620 Pyruvate metabolism
    ASAC_1054
   00640 Propanoate metabolism
    ASAC_1054
   00650 Butanoate metabolism
    ASAC_1054
  Energy metabolism
   00680 Methane metabolism
    ASAC_1054
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    ASAC_1054
Enzymes [BR:asc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     ASAC_1054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1055186..1056388)
Genome map
AA seq 400 aa AA seqDB search
MTMKALTGNHAVSEAVKLARVEVIAAYPITPQTTMVEKLAEMVDKGELEAKMIRVESEHS
ALAATLGAAAAGARAFTATSSHGLLYMHEVLWWTAGARIPVVMAVAARAIGPPWNIHVEH
SDVMDQRDTGWIISVAQENQEAFDLTLQAFRISEDPRVYLPMIVTLDGFILSHTVAPVDI
PSQEEVDNWLPPRRQPYVITPESNVVMGNIASDEDYFMMRYSIQAAMKAAKQVISEVDLE
YGKAFGRSYGGLVECYRCDDADYVIVITGSWAGDAKKAADMLRDKGVRAGVARIRFVRPW
PEEDLRDKLSNKKGVIVFDRSVSFGSYGQLFSDTAATLYGTKVSMRGVIAGLGGVDVRPD
DIMSEVMDFVGRVEEVGLVYEPQRWMLPKKYAQVGKEVGL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgaaagctctgacaggcaaccatgcggtctctgaagctgtgaagctggctagg
gtcgaggtaatagcggcttacccgataactcctcagacaaccatggttgagaagctcgcc
gagatggtggacaaaggcgagcttgaggctaagatgataagggtggagagcgagcacagc
gccctagcagccaccctaggagcggcggcagcaggggccagggctttcacggcaacttca
agtcatgggctcctgtatatgcatgaggtgctctggtggaccgcaggggccaggataccg
gtcgttatggctgtggcggccagggccatagggccgccgtggaacatccacgttgagcac
agcgacgtcatggatcagagggacaccgggtggataatatctgtggcccaggagaaccag
gaggcgtttgacctgacgctgcaggccttcaggataagcgaggaccccagggtatacctt
cccatgatcgtcacacttgacggcttcatattatcccacacagtggcccccgtagacata
ccttcacaggaggaggtcgacaactggttgccgccgaggaggcagccctacgtgatcacg
cctgagagcaacgtggtaatgggcaacatagcgtcggacgaggactacttcatgatgagg
tactccatacaggcggccatgaaggcggccaagcaggttataagtgaggttgaccttgag
tatggaaaggcctttggaaggtcttacggcggactggtggagtgctaccgctgcgacgac
gcggattacgtgatagtaataacgggcagctgggccggcgacgctaagaaggccgctgat
atgttgagggacaagggagttagggcgggcgtcgcgaggatcaggtttgtcaggccatgg
cctgaggaggacctcagggataagctatccaacaagaagggggtaatagtgtttgacagg
agcgtctcatttggaagctatgggcagctcttcagcgacacggcggcaacgctgtacgga
accaaggtgtccatgagaggcgtcatagcgggacttggaggcgtcgacgtgaggcctgat
gacataatgtctgaggttatggatttcgtaggcagggttgaggaggtgggcctcgtgtat
gaaccgcagaggtggatgctgcctaagaagtatgcccaggtaggtaaggaggtgggcctc
tga

DBGET integrated database retrieval system