KEGG   Acidilobus saccharovorans: ASAC_1055Help
Entry
ASAC_1055         CDS       T01283                                 

Definition
(GenBank) 2-Ketoisovalerate:ferredoxin oxidoreductase (VOR), delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
asc  Acidilobus saccharovorans
Pathway
asc00010  Glycolysis / Gluconeogenesis
asc00020  Citrate cycle (TCA cycle)
asc00620  Pyruvate metabolism
asc00640  Propanoate metabolism
asc00650  Butanoate metabolism
asc00680  Methane metabolism
asc00720  Carbon fixation pathways in prokaryotes
asc01100  Metabolic pathways
asc01120  Microbial metabolism in diverse environments
asc01130  Biosynthesis of antibiotics
asc01200  Carbon metabolism
Module
asc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:asc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASAC_1055
   00020 Citrate cycle (TCA cycle)
    ASAC_1055
   00620 Pyruvate metabolism
    ASAC_1055
   00640 Propanoate metabolism
    ASAC_1055
   00650 Butanoate metabolism
    ASAC_1055
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    ASAC_1055
   00680 Methane metabolism
    ASAC_1055
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    ASAC_1055
Enzymes [BR:asc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     ASAC_1055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_7 Fer4_6 Fer4_10 Fer4_16 Fer4_2 Fer4_9 Fer4_13 Fer4_15 Fer4_8 Fer4_17 Fer4_4 Fer4_3 Fer4_22
Motif
Other DBs
NCBI-ProteinID: ADL19460
UniProt: D9Q2C2
Position
complement(1056385..1056648)
Genome map
AA seq 87 aa AA seqDB search
MPISYPAEGSSGKTGLWRTERPVVHLDKCIKCLFCWLYCPEDTILRREDDYVYVDYDYCK
GCGICAQACPTHAIEMVPEPSLGSERA
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
gtgccaatatcatatccggccgaggggtcctcaggcaagacaggcctctggaggactgag
cggccggtggtgcatttggataagtgcattaagtgcctcttctgctggctctactgcccc
gaggacacaatactaaggagggaggacgactatgtttatgtggactatgactattgcaag
gggtgcggcatctgcgctcaggcatgcccaacgcacgcgatagagatggtacctgaacca
tcgctagggagtgagagggcatga

DBGET integrated database retrieval system