KEGG   Acidilobus saccharovorans: ASAC_1073Help
Entry
ASAC_1073         CDS       T01283                                 

Definition
succinyl-CoA synthetase beta chain (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
asc  Acidilobus saccharovorans
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:asc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ASAC_1073
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ASAC_1073
   00640 Propanoate metabolism
    ASAC_1073
   00660 C5-Branched dibasic acid metabolism
    ASAC_1073
Enzymes [BR:asc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ASAC_1073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1074740..1075888)
Genome map
AA seq 382 aa AA seqDB search
MGGPVKLFEYEAKEIIRKYGIETPKGVVVREGDDIRKAIESSGLTPPLAVKAQVLVAGRG
KAGGIKLVNNVDEAVSVSQQLFKTPIKGIKPSILLIEQAIKHDAELYAGIVLDRAERKPL
VLVSKYGGMDLEEVAREHPEAIIKYYVDPYKGLRNYEARILGKQLGLTGKALSSFENFLQ
ALYRAFMDYDAELAESNPLALLPDKVLPLDLRIIIDDNSLFRHTEYAATEKERLGELSER
EIAAREKDLAYVELDGDVGVIGNGAGLTMTTMDLVYEFGMKPADFLDVGGGAEAEHIRDA
VEFVMSDPKVKKVFINIFGGITRADEVARGIVMALKDLGNKAKPLVVRLTGTNEEQGREI
LKEVGITPYSDPLEALQALKNL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgggcctgtgaagctgtttgagtatgaggctaaggagatcataaggaagtacggc
atcgaaacgccgaagggcgtcgtagtgcgcgagggtgacgatataaggaaggccatagaa
agctcgggcctaacccctccactggccgttaaggcgcaggtcctggttgccggaaggggc
aaggccggcggaataaagcttgtaaataacgttgacgaggccgtctcggtgtcccagcag
ctcttcaagactccaatcaagggaataaagccctctatcctgcttatagagcaggccata
aagcatgatgcggagctctacgctggaatagtgcttgatagggccgagaggaagcccctc
gtgctggtaagcaagtacggtggcatggatcttgaggaggttgccagggagcaccccgag
gccataataaagtactacgtggacccatacaagggactaagaaattatgaggccagaata
ctgggcaagcagcttggcctcacaggcaaagcactttcaagctttgagaacttcctgcag
gcgctgtacagggcatttatggactatgacgctgagctcgccgagagcaacccgttggcg
cttctgccagacaaggttctgcccctcgacctcaggataataatcgacgacaatagcctc
ttcaggcacacggagtacgccgccaccgagaaggagaggctcggagagctcagcgagagg
gagatagcggccagagagaaggaccttgcctacgtggaacttgacggtgatgtcggggtt
atcggaaacggggcagggctcactatgaccaccatggacctcgtctacgagtttggaatg
aagcctgccgacttccttgacgtaggagggggagctgaggctgagcacataagggatgcc
gttgagttcgttatgagtgaccccaaggtcaagaaggtgttcataaacatattcggaggc
ataactagggccgacgaagttgccaggggcatagtaatggcgctcaaggacctgggcaac
aaggccaagcccctagttgtgaggttaactgggaccaacgaggagcagggaagggagatt
cttaaggaagtgggcataacgccatacagtgacccgctggaggcgcttcaggcgcttaag
aacctgtga

DBGET integrated database retrieval system