KEGG   Acidilobus saccharovorans: ASAC_1073Help
Entry
ASAC_1073         CDS       T01283                                 

Definition
succinyl-CoA synthetase beta chain (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
asc  Acidilobus saccharovorans
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:asc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ASAC_1073
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ASAC_1073
   00640 Propanoate metabolism
    ASAC_1073
   00660 C5-Branched dibasic acid metabolism
    ASAC_1073
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    ASAC_1073
Enzymes [BR:asc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ASAC_1073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1074740..1075888)
Genome map
AA seq 382 aa AA seqDB search
MGGPVKLFEYEAKEIIRKYGIETPKGVVVREGDDIRKAIESSGLTPPLAVKAQVLVAGRG
KAGGIKLVNNVDEAVSVSQQLFKTPIKGIKPSILLIEQAIKHDAELYAGIVLDRAERKPL
VLVSKYGGMDLEEVAREHPEAIIKYYVDPYKGLRNYEARILGKQLGLTGKALSSFENFLQ
ALYRAFMDYDAELAESNPLALLPDKVLPLDLRIIIDDNSLFRHTEYAATEKERLGELSER
EIAAREKDLAYVELDGDVGVIGNGAGLTMTTMDLVYEFGMKPADFLDVGGGAEAEHIRDA
VEFVMSDPKVKKVFINIFGGITRADEVARGIVMALKDLGNKAKPLVVRLTGTNEEQGREI
LKEVGITPYSDPLEALQALKNL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgggcctgtgaagctgtttgagtatgaggctaaggagatcataaggaagtacggc
atcgaaacgccgaagggcgtcgtagtgcgcgagggtgacgatataaggaaggccatagaa
agctcgggcctaacccctccactggccgttaaggcgcaggtcctggttgccggaaggggc
aaggccggcggaataaagcttgtaaataacgttgacgaggccgtctcggtgtcccagcag
ctcttcaagactccaatcaagggaataaagccctctatcctgcttatagagcaggccata
aagcatgatgcggagctctacgctggaatagtgcttgatagggccgagaggaagcccctc
gtgctggtaagcaagtacggtggcatggatcttgaggaggttgccagggagcaccccgag
gccataataaagtactacgtggacccatacaagggactaagaaattatgaggccagaata
ctgggcaagcagcttggcctcacaggcaaagcactttcaagctttgagaacttcctgcag
gcgctgtacagggcatttatggactatgacgctgagctcgccgagagcaacccgttggcg
cttctgccagacaaggttctgcccctcgacctcaggataataatcgacgacaatagcctc
ttcaggcacacggagtacgccgccaccgagaaggagaggctcggagagctcagcgagagg
gagatagcggccagagagaaggaccttgcctacgtggaacttgacggtgatgtcggggtt
atcggaaacggggcagggctcactatgaccaccatggacctcgtctacgagtttggaatg
aagcctgccgacttccttgacgtaggagggggagctgaggctgagcacataagggatgcc
gttgagttcgttatgagtgaccccaaggtcaagaaggtgttcataaacatattcggaggc
ataactagggccgacgaagttgccaggggcatagtaatggcgctcaaggacctgggcaac
aaggccaagcccctagttgtgaggttaactgggaccaacgaggagcagggaagggagatt
cttaaggaagtgggcataacgccatacagtgacccgctggaggcgcttcaggcgcttaag
aacctgtga

DBGET integrated database retrieval system