KEGG   Acidilobus saccharovorans: ASAC_1201Help
Entry
ASAC_1201         CDS       T01283                                 

Definition
hemD uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
asc  Acidilobus saccharovorans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:asc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ASAC_1201
Enzymes [BR:asc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ASAC_1201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1189056..1189730)
Genome map
AA seq 224 aa AA seqDB search
MGPELPTALSGFSCIKWIKSVEILPLPEALRAAAEYVVRGDYDCVAFLSPRSPRFLRQFM
SSWPPNVRAFAVGASTAASVREAFGIDAPYPETYSSGGLAELIKLSHCRRVLSLRSEAGD
HELEEKLREAGIEVNRVDVYREVPADIDINELASRFDLIIVSSAEIARISCNHVRPYLGD
AIVIAMGPKAASAVSSMCPEARLLVPSRYTFNAIGELLKALGCR
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
ttggggccagagctcccaacagcgctgagcggcttcagctgcatcaagtggataaagtct
gttgagatattgcctcttcccgaggccctgagggctgcagctgaatatgtagtcagaggt
gattatgattgtgttgccttcctgagcccaaggtccccgaggtttctaaggcaatttatg
agctcctggccgcctaatgtcagggcgttcgcagttggcgcttccacggcggcgtccgtc
agggaagcttttggcatagatgccccgtaccctgagacctacagcagcggcggacttgct
gagctcattaagttgtcccactgcaggagggtcctgagcctaaggtccgaggccggggac
cacgagcttgaggaaaagcttagggaggcggggattgaggtaaacagggttgatgtatat
cgtgaggttccagcagacatagacataaatgagctggcctctcgctttgacctaataata
gtgtcctctgccgagatagccagaatttcatgtaatcatgtaagaccttacctgggcgat
gccatagttatagcgatgggacctaaggcggcctcggctgttagctccatgtgccctgag
gccaggcttcttgtcccgtcccggtatacgtttaatgccattggagagctactgaaagcg
ctcgggtgcaggtga

DBGET integrated database retrieval system