KEGG   Acidilobus saccharovorans: ASAC_1216Help
Entry
ASAC_1216         CDS       T01283                                 

Definition
Molybdenum cofactor biosynthesis protein
Orthology
K03750  
molybdopterin molybdotransferase [EC:2.10.1.1]
Organism
asc  Acidilobus saccharovorans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1204033..1205307
Genome map
AA seq 424 aa AA seqDB search
MSVKRTMEGFKMLVSVDEALRSILDNINLTPDVIEVNIQDALGLPVAEDVVAPLDVPPFD
RSAVDGYAVRSSDTLGATLLNPVRLRIVGEVQAGDDPSRLPRVGEGEAATIYTGAPLPPG
ADAVVMAEDASRVGEYVEVKRQVTPYMNVSRKGEDFTKGKIVIRRGYKVQPWHVGALASL
GIRKIKVFRRLKVAVLSTGSEVVELDDPRAGTPGTIINSTKPMLISLLRQDGFEPIDMGT
VPDDADMIRSKISEGLRVADAIITTGGTSLGAYDLVPDVVARMGKVLFNGVRMRPGKPTG
AGIINGKPVFMLSGFPVASLTGYITFVRPTLRHMTGTPEDPVPIVKGKITRRVANVAGIR
TYLRVRVYPNERGELMVEPLAITASGVLSTLTDANAILVLNENVEGYDAGDEVEVMLISP
LEAY
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtaaagagaaccatggaaggctttaagatgctagtgagtgtcgacgaggcgctc
aggagcatcctagataatataaacttaacaccagatgtaatagaggtaaacatacaggac
gccttaggcctgccggtggctgaggacgtggtagcaccgttggacgtgccgccctttgat
agaagcgccgtcgacggctatgctgtgaggtcatccgacaccctcggggctaccctcctt
aaccctgtgaggctcaggattgtgggcgaagttcaggctggtgatgacccatcaaggctc
ccacgggttggcgagggcgaggccgcaacaatatacaccggggcgccgctgcccccagga
gctgatgctgtagtaatggccgaggatgcgtccagggtcggggagtatgtcgaggttaaa
aggcaggtgactccatatatgaacgtctcgagaaaaggcgaagacttcactaagggtaag
atagtgattagaaggggctataaggttcagccatggcatgtaggcgccctggcctcgctg
ggcataaggaaaatcaaggtattcagaaggttaaaggttgccgttctctccactggcagc
gaggtagtggagctggacgacccgcgcgccggcaccccgggaacaataataaacagcacg
aagcccatgctgatttcattgcttaggcaggacggctttgagcccatagatatgggtacg
gtgcctgacgacgctgacatgataaggtcaaagatatccgaggggctgagggtcgccgac
gccattataactacggggggcaccagcctgggggcctacgatctagtccccgacgttgtt
gctcgcatgggcaaggtgctttttaacggcgtcaggatgaggcctgggaagcccacgggc
gccggcataatcaacggcaagcctgttttcatgctctcagggttcccagtggcgtctctt
acaggctacataacgtttgtaaggccgactctgaggcatatgacaggcacccccgaggac
ccggtgcccatagtaaagggcaagataactagaagggtggctaacgtggcgggcataagg
acctacttgagggtgagagtgtaccccaacgaaagaggggaactcatggttgagccccta
gcgataacagcgtcaggggtgctctccacgctaacggacgctaacgcaatactagtactt
aatgagaacgtggaaggctacgatgctggggatgaggtcgaggtcatgctaatttcccca
cttgaagcttactaa

DBGET integrated database retrieval system