KEGG   Acidilobus saccharovorans: ASAC_1230Help
Entry
ASAC_1230         CDS       T01283                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
asc  Acidilobus saccharovorans
Pathway
asc00010  Glycolysis / Gluconeogenesis
asc00051  Fructose and mannose metabolism
asc00562  Inositol phosphate metabolism
asc01100  Metabolic pathways
asc01110  Biosynthesis of secondary metabolites
asc01120  Microbial metabolism in diverse environments
asc01130  Biosynthesis of antibiotics
asc01200  Carbon metabolism
asc01230  Biosynthesis of amino acids
Module
asc_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:asc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASAC_1230
   00051 Fructose and mannose metabolism
    ASAC_1230
   00562 Inositol phosphate metabolism
    ASAC_1230
Enzymes [BR:asc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ASAC_1230
Exosome [BR:asc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ASAC_1230
  Exosomal proteins of bladder cancer cells
   ASAC_1230
  Exosomal proteins of melanoma cells
   ASAC_1230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ThiG TIM Trp_syntA NMO His_biosynth FMN_dh IMPDH IGPS DUF561 G3P_antiterm
Motif
Other DBs
NCBI-ProteinID: ADL19635
UniProt: D9Q2U7
Position
1213295..1213972
Genome map
AA seq 225 aa AA seqDB search
MPRLVFAVNFKAYETAFNEKSLEIAREASKASSRYGNVRVILIVPAAIASKVLQIYDDVY
IEHADPVDYGAYTGYLPAKAARLLGVRGILVNHSEHKMIYRDVAKVVETASKDGIETMAC
ADTPGEAAGLAYLRPTYIAIEPPELIGTGVSVSKARPEVITEGVKAVKAVADIPVLAGAG
ITYREDVVRAVQLGASGILLASAVMKAADPDKALSEFVDALSSVA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgcctaggctggtcttcgccgtaaattttaaggcatacgagaccgcatttaatgagaag
tcgctggagatagctagggaggcgtcaaaggcctcctcaagatacggcaacgtccgggtt
attctcatagtgcctgctgcgattgcatcaaaggtgctccaaatttacgacgacgtctac
attgagcatgcagatcccgtggactacggggcttacacgggctacctgccagctaaggca
gctaggctgcttggagttaggggcattctagtaaatcacagtgaacacaagatgatctac
agggacgtagctaaggttgtcgaaacggcgtccaaggacggcatagaaactatggcctgc
gccgacacgcctggcgaggccgctgggctggcttacttgaggccaacctacatagcaatt
gagccgccagagctcataggcactggggtctcagtttccaaggccaggcctgaagttatc
actgagggcgttaaggccgtaaaggcagtggccgatatacctgtgctggccggcgctggg
atcacgtatagggaggacgtcgtacgtgcagtgcaactcggcgccagcggcatactgctg
gcaagcgctgtaatgaaggccgcggatccggacaaagcgctcagcgagttcgtagatgcg
ctcagctctgttgcatga

DBGET integrated database retrieval system