KEGG   Acidilobus saccharovorans: ASAC_1230Help
Entry
ASAC_1230         CDS       T01283                                 

Definition
Triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
asc  Acidilobus saccharovorans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:asc01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:asc01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:asc00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:asc00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:asc00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1213295..1213972
Genome map
AA seq 225 aa AA seqDB search
MPRLVFAVNFKAYETAFNEKSLEIAREASKASSRYGNVRVILIVPAAIASKVLQIYDDVY
IEHADPVDYGAYTGYLPAKAARLLGVRGILVNHSEHKMIYRDVAKVVETASKDGIETMAC
ADTPGEAAGLAYLRPTYIAIEPPELIGTGVSVSKARPEVITEGVKAVKAVADIPVLAGAG
ITYREDVVRAVQLGASGILLASAVMKAADPDKALSEFVDALSSVA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgcctaggctggtcttcgccgtaaattttaaggcatacgagaccgcatttaatgagaag
tcgctggagatagctagggaggcgtcaaaggcctcctcaagatacggcaacgtccgggtt
attctcatagtgcctgctgcgattgcatcaaaggtgctccaaatttacgacgacgtctac
attgagcatgcagatcccgtggactacggggcttacacgggctacctgccagctaaggca
gctaggctgcttggagttaggggcattctagtaaatcacagtgaacacaagatgatctac
agggacgtagctaaggttgtcgaaacggcgtccaaggacggcatagaaactatggcctgc
gccgacacgcctggcgaggccgctgggctggcttacttgaggccaacctacatagcaatt
gagccgccagagctcataggcactggggtctcagtttccaaggccaggcctgaagttatc
actgagggcgttaaggccgtaaaggcagtggccgatatacctgtgctggccggcgctggg
atcacgtatagggaggacgtcgtacgtgcagtgcaactcggcgccagcggcatactgctg
gcaagcgctgtaatgaaggccgcggatccggacaaagcgctcagcgagttcgtagatgcg
ctcagctctgttgcatga

DBGET integrated database retrieval system