KEGG   Acidilobus saccharovorans: ASAC_1285Help
Entry
ASAC_1285         CDS       T01283                                 

Definition
aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
asc  Acidilobus saccharovorans
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:asc00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ASAC_1285
Enzymes [BR:asc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     ASAC_1285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1268798..1269376
Genome map
AA seq 192 aa AA seqDB search
MRLNEEVMEVVADVMRLLYQRGLVQVKGGNVSVIDRSSGLVYITPTGVPRHQLKADDIAV
MTLDGNVIVGTPSSEFRMHLGIYSSIPSAVSVVHAHPPKVIALYELGSKLDLSITTEAKA
RVNCVSEVPYVKPGTPELAAAVSDALKQCQAAALRGHGIVAYSSRDVYEALDIVEALSDL
AEVQLYINLMRR
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
ttgaggttgaatgaggaagtaatggaagtcgttgcagatgttatgaggctcctttaccag
agggggctagtacaagtgaaggggggtaacgtcagtgtcatagacaggtcgtcaggactt
gtttacataactccgacgggagttccaaggcatcagcttaaggccgacgacatagcagtt
atgactcttgacggtaacgtgatagttggaaccccgagcagcgagttcaggatgcaccta
ggcatctacagttcaataccttcagccgtgagcgttgtccacgctcacccacctaaggtg
atagcgctctacgagctcgggtctaagctcgatctttccataactacagaggccaaggca
agagttaattgcgtcagcgaggtaccttatgtaaagcctggcaccccagagctcgcggct
gcggtaagcgacgcgcttaagcagtgccaggcggccgcgctcagaggccacggcatagtg
gcctactcctctcgcgacgtctatgaggcccttgatattgttgaagccctgagtgacctg
gccgaggttcaactgtacattaacttaatgagaaggtga

DBGET integrated database retrieval system