KEGG   Acidilobus saccharovorans: ASAC_1285Help
Entry
ASAC_1285         CDS       T01283                                 

Definition
aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
asc  Acidilobus saccharovorans
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:asc00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1268798..1269376
Genome map
AA seq 192 aa AA seqDB search
MRLNEEVMEVVADVMRLLYQRGLVQVKGGNVSVIDRSSGLVYITPTGVPRHQLKADDIAV
MTLDGNVIVGTPSSEFRMHLGIYSSIPSAVSVVHAHPPKVIALYELGSKLDLSITTEAKA
RVNCVSEVPYVKPGTPELAAAVSDALKQCQAAALRGHGIVAYSSRDVYEALDIVEALSDL
AEVQLYINLMRR
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
ttgaggttgaatgaggaagtaatggaagtcgttgcagatgttatgaggctcctttaccag
agggggctagtacaagtgaaggggggtaacgtcagtgtcatagacaggtcgtcaggactt
gtttacataactccgacgggagttccaaggcatcagcttaaggccgacgacatagcagtt
atgactcttgacggtaacgtgatagttggaaccccgagcagcgagttcaggatgcaccta
ggcatctacagttcaataccttcagccgtgagcgttgtccacgctcacccacctaaggtg
atagcgctctacgagctcgggtctaagctcgatctttccataactacagaggccaaggca
agagttaattgcgtcagcgaggtaccttatgtaaagcctggcaccccagagctcgcggct
gcggtaagcgacgcgcttaagcagtgccaggcggccgcgctcagaggccacggcatagtg
gcctactcctctcgcgacgtctatgaggcccttgatattgttgaagccctgagtgacctg
gccgaggttcaactgtacattaacttaatgagaaggtga

DBGET integrated database retrieval system