KEGG   Acidilobus saccharovorans: ASAC_1295Help
Entry
ASAC_1295         CDS       T01283                                 

Definition
Tungsten-containing aldehyde:ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
asc  Acidilobus saccharovorans
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:asc01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:asc00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1277689..1279590)
Genome map
AA seq 633 aa AA seqDB search
MTRLKGYGGKVLRVDLTHRTYRAEELDPSLAKAFIGGRGLNAYRLYWEVPPGVDPLGPEN
KLMIATGPLVGFPHGLGSRLNVTSRSPLTGLLGDSNAGTHFSEEMKFAGYDQIIIEGRSE
RPVYLYITESGVEFMDAEGLWGFTVSQTHEAIRHELGDQRVQVGAVGPAAENLVKFAGVF
FNVYRAAGRTGMGTVLASKNVKAIAVRGDGYIEAENVDELIKVIDEMLRRIYENPQYWPR
RIMGTSRVLMAGQRLGFLPGRHFQDPVVDYAYDVSGERLAREYNVKVRACSAGCALPCAR
FFMIKRGPLAGLMGEGPEYEPLGGFTVRVGNRDLDRALKIILKVADYGMDAITTSEVIAW
LMELRQRGEITDEEAGVKLEWGNPDTIEELVDMIAYRRGIGKVLAEGVKRASEMLNRGKD
IAFHVKGLEMIQADPRALKGYGLGFAVASRGADHLRSEPFVEVEDDPELGKKMFGEPEAA
MRLGVKGKGKLINYFEDLNAIVDSFESCKNTAENMLILDFDMAARAYTAITGIHVTESEM
REAGMRIVNIERAYLVREGVRRSHDRLPKRFLEEPLRSGPAKGHVIELDVMLDEYYDVRG
WTRDGVPRRSTLLRLGLKEVAMDLEARGIKLED
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
ttgacgaggcttaagggctatggagggaaggtgctcagggtagaccttactcacagaaca
tacagggctgaggagctcgacccctcgctcgccaaggccttcataggcggcagggggctc
aacgcctacaggctatactgggaggttccgccgggcgtcgacccgctggggcctgagaac
aagctaatgatagcgacggggcccctggtaggcttcccccacggccttgggtcgaggctt
aacgtgacctcccgctcgcccctgacaggcctcctcggggactccaacgcaggcactcac
ttctccgaggagatgaagttcgccggctatgaccagataatcatagagggcagaagtgaa
aggcctgtgtacctgtacatcacggagtcaggcgttgagttcatggatgccgagggcctc
tgggggttcaccgtgtcgcagacccacgaggctataaggcatgaactcggggatcagagg
gtccaggtgggcgcagttgggcctgcggctgaaaaccttgtgaagttcgctggggtcttc
ttcaacgtctacagggccgccggcaggactggcatggggacggtgttggcctccaagaac
gttaaggcaatagccgtgaggggggacggctacattgaagctgagaacgtagatgagctc
atcaaggttatagatgagatgctccgcagaatctatgagaacccgcagtactggccaagg
agaataatgggcacgtcgagggtgctgatggccggccagaggcttggctttctcccaggg
aggcacttccaggacccagtggttgactacgcgtatgatgtcagcggcgagaggctcgcc
agggagtacaacgttaaggtgagggcgtgctcggccggctgcgcactgccctgcgcgagg
ttcttcatgataaagagggggccgctggccggcctcatgggtgaggggcctgagtacgag
cccctcggcggcttcaccgtcagggtgggcaacagggacctggacagggcgctcaagata
atactcaaggtggcggactacggcatggacgccataaccacgagcgaggtcatagcttgg
ctcatggagctgaggcagcgcggtgagataacggatgaggaggccggcgtgaagctggag
tggggcaaccctgacacaatagaggagctcgtggacatgatagcctacaggaggggcata
ggcaaggtcctggcagagggcgtcaagagggcctctgagatgctgaacagaggcaaggac
atagcgttccacgttaaggggctggagatgatacaggcggacccgagggccctcaagggc
tacggcctcggctttgcggtggccagcaggggagcggatcacctcaggtctgagcccttc
gttgaggttgaggacgatcctgagcttggcaagaagatgttcggggagcccgaggcagcg
atgaggctaggcgtcaagggtaagggcaagctgataaactactttgaggacctcaatgca
atcgtagattcgtttgagtcctgtaaaaacacggcagagaacatgctaatacttgacttt
gatatggccgccagggcctacaccgcaatcacaggaatccacgtcaccgagagcgagatg
agggaggccggcatgaggatagttaacatagagagggcctacctagtcagggaaggagtg
aggaggtcccacgacaggctgccgaagaggttcctggaggagccgctgaggagcgggcca
gctaaggggcacgtgatagaacttgacgtcatgttagatgaatattatgacgtgagaggc
tggaccagggatggcgtaccaaggaggtccaccctactaaggctggggctcaaggaggtg
gccatggacttggaggccaggggaataaagctcgaggactag

DBGET integrated database retrieval system