KEGG   Acidilobus saccharovorans: ASAC_1441Help
Entry
ASAC_1441         CDS       T01283                                 

Definition
succinate:quinone oxidoreductase, hydrophobic anchor subunit D
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
asc  Acidilobus saccharovorans
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:asc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ASAC_1441
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ASAC_1441
   00650 Butanoate metabolism
    ASAC_1441
  Energy metabolism
   00190 Oxidative phosphorylation
    ASAC_1441
   00720 Carbon fixation pathways in prokaryotes
    ASAC_1441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1430701..1431060)
Genome map
AA seq 119 aa AA seqDB search
MSSGKASSVQIWQYITAILLIGLLGFHLLERVPWIWGVSTMDQTLTAAFVYSDYVHFGWA
LLLLAYVALFHGLNGVRGMLLELRQGRMYTATINALFWIVFIVFAAIATLTVVKLPAYP
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcggtaaggcctcgagcgttcagatctggcagtacataactgccatactgctc
atagggctgcttggcttccacctgcttgagagggtgccctggatctggggcgtgtctacg
atggaccagaccctgaccgccgccttcgtctacagtgactacgtgcacttcggctgggcg
ctgctcctcctggcctacgttgcgctcttccacggcctcaacggcgtcaggggcatgttg
cttgagctcaggcagggcaggatgtacacggcaaccataaacgccctcttctggatagtg
tttatcgtgttcgccgctatagccacactaactgtggtaaagctgcctgcttacccgtga

DBGET integrated database retrieval system