KEGG   Amycolicicoccus subflavus: AS9A_0011Help
Entry
AS9A_0011         CDS       T01514                                 

Definition
putative alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
asd  Amycolicicoccus subflavus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AS9A_0011
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AS9A_0011
  Lipid metabolism
   00071 Fatty acid degradation
    AS9A_0011
  Amino acid metabolism
   00350 Tyrosine metabolism
    AS9A_0011
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AS9A_0011
   00626 Naphthalene degradation
    AS9A_0011
Enzymes [BR:asd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AS9A_0011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13219..14361
Genome map
AA seq 380 aa AA seqDB search
MAVKSRSAVLSNMGQSRPFAETAPLQILDVDIDSPGPGEVLVQIEAAGVCHSDLSVLTGQ
RPRPMPMAIGHEAAGRVVEVGPDVPGIGPDDHVVLAFMPHCGACANCVAGRTTLCIPGGQ
SNREGALLGGHHRLNVGGRRVNHHLGVSAFSEYAVVHHSSAVVIDDDIPFEIAAVFGCAM
LTGAGAVLNTAGVQQGESVCVIGLGGVGLAAVLGAVIAGANPIVAIDPVESKRQLALELG
ATHACHPGDAARLIGSLTRDGTRWAIEAAGVVPAMEQAFSLIGRGGAVVSVGLPAPDAQL
TLPAVAFVADAKSFIGSYMGSCQPQRDIPRMIAWWRQGLLPVEKLVDGTYPLSSVNWAMD
RLAEGAAVRQILLPQMQETE
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
gtggctgtgaaatcacgctctgcggttctgtcgaacatgggacagtcgcgtcctttcgcg
gaaaccgcaccactgcagattctcgacgtggacatcgattcgccgggcccgggtgaggtg
ctagtgcagatcgaggctgccggtgtctgccattcagatctgtcagtactcacgggccag
cgaccccgacctatgcctatggcgattggccacgaggctgcggggcgcgttgtggaagtg
gggcccgacgttccaggtatcgggcctgacgaccacgtggtgcttgctttcatgccgcat
tgcggcgcgtgcgcgaattgcgtagcggggagaacgacactctgcattcccgggggacag
agcaaccgagaaggcgctctgctgggcggtcatcaccggctcaatgtgggcgggcggcgt
gtcaaccaccatcttggagtttctgcattcagtgaatacgcggtcgtgcaccattcgtcc
gcagttgtgatcgacgacgatattcccttcgagatcgccgcggtgttcggctgtgccatg
ctcaccggtgcaggagcagtcctcaacacagcgggagtgcagcagggtgaaagcgtatgc
gttatcggcctcgggggtgtgggactcgctgccgtccttggtgcggtcattgcgggagcc
aacccgatcgtcgcgatcgacccagtggaatcgaagcgacaactggcgctcgaactcggt
gctacacacgcgtgccatccgggggatgccgctcgcctcattggcagcctgacaagggac
gggacgagatgggcgatcgaagcggcaggcgtggtcccagcgatggaacaggctttttca
ctgatcggccgtggcggcgcggtggtctccgtcgggctgcccgcgccggacgcgcaattg
acgctcccagctgtggctttcgtggctgatgcgaagagtttcatcggctcatacatgggc
tcctgtcagccgcagcgtgacattcccaggatgatcgcgtggtggcggcagggccttctg
cctgtcgagaagctggtggacggaacgtatccgttgagctcggtgaattgggcgatggat
cgactggccgaaggcgcagcggtccggcagatccttcttccccagatgcaggagacggag
tga

DBGET integrated database retrieval system