KEGG   Amycolicicoccus subflavus: AS9A_0171Help
Entry
AS9A_0171         CDS       T01514                                 

Definition
acetaldehyde dehydrogenase 2
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
asd  Amycolicicoccus subflavus
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:asd00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:asd00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:asd00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:asd00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:asd00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
191568..192515
Genome map
AA seq 315 aa AA seqDB search
MTLTKVAVVGSGNIGTDLVIKLESIAKNVEMAVLVGIDPQSDGLARARRLGISTVDRGVQ
GLIEHPEFDSIDIIFDSTSATAHLANEAALRPFGKRIIDLTPAAVGPYVVPAVNLNEHLD
APNVNMVTCGGQATIPIVAAISAVTAVHYAEIVASIASKSAGPGTRANIDEFTETTSEAI
EKVGGAEHGKAIIVMNPAEPPLIMRDTVLALVTNPDQDRIRRSVEDMVASVAAYVPGYRL
KQEVQFTELDEAESVSTLTGGVDKGPGLWKVSVFLEVEGAAHYLPAYAGNLDIMTSAALQ
VAEKLAEKKDLETAR
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgactctcaccaaagtggccgtcgtcgggtccggcaatatcggcaccgatctggtcatc
aaactcgaaagcatcgccaagaacgtcgagatggccgtcctggttggcatcgatccccag
tccgatgggctcgcacgggcgcgacgattgggcatcagcaccgtggaccgaggcgtccaa
ggtctgatcgaacaccccgagttcgactccatcgacatcatcttcgactcgacgtccgcg
accgcgcacctcgcgaacgaggcggccctgcggcccttcggtaaacggatcatcgacctg
accccggcggccgtaggcccctatgtcgttcccgccgtcaacctgaacgagcatctcgat
gcgcccaacgtcaacatggttacctgcggtgggcaggcaaccatcccgattgtggcggcg
atctctgctgtgacagcagtccactacgccgaaatcgtagcgtccatcgcctcgaaatcc
gcaggaccaggtacccgcgccaacatcgacgaattcaccgaaaccacctctgaagcaatc
gaaaaggtcggcggagcagaacacggcaaagcaatcatcgtgatgaacccggccgagcct
ccgctgatcatgcgcgacaccgtgttggcgctggtgaccaaccccgatcaggatcggatt
cgccggtcagtcgaggacatggtcgcttcggtcgccgcatacgttcctggataccgcctc
aaacaagaagtccagttcaccgaactcgacgaggccgagtcggtctccacgctcaccggc
ggtgtcgacaaaggccctggattgtggaaggtatcggtgttcctcgaggtcgagggtgct
gcgcactacctccctgcatacgcgggaaacctggacatcatgacctctgccgccctgcag
gtcgccgagaaattggcggaaaagaaagatttggagacagcacgatga

DBGET integrated database retrieval system