KEGG   Hoyosella subflava: AS9A_0171Help
Entry
AS9A_0171         CDS       T01514                                 

Definition
(GenBank) Acetaldehyde dehydrogenase 2
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
asd  Hoyosella subflava
Pathway
asd00360  Phenylalanine metabolism
asd00362  Benzoate degradation
asd00620  Pyruvate metabolism
asd00621  Dioxin degradation
asd00622  Xylene degradation
asd00650  Butanoate metabolism
asd01100  Metabolic pathways
asd01120  Microbial metabolism in diverse environments
asd01220  Degradation of aromatic compounds
Module
asd_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AS9A_0171
   00650 Butanoate metabolism
    AS9A_0171
  Amino acid metabolism
   00360 Phenylalanine metabolism
    AS9A_0171
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AS9A_0171
   00622 Xylene degradation
    AS9A_0171
   00621 Dioxin degradation
    AS9A_0171
Enzymes [BR:asd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     AS9A_0171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AEF38631
UniProt: F6EF52
Position
191568..192515
Genome map
AA seq 315 aa AA seqDB search
MTLTKVAVVGSGNIGTDLVIKLESIAKNVEMAVLVGIDPQSDGLARARRLGISTVDRGVQ
GLIEHPEFDSIDIIFDSTSATAHLANEAALRPFGKRIIDLTPAAVGPYVVPAVNLNEHLD
APNVNMVTCGGQATIPIVAAISAVTAVHYAEIVASIASKSAGPGTRANIDEFTETTSEAI
EKVGGAEHGKAIIVMNPAEPPLIMRDTVLALVTNPDQDRIRRSVEDMVASVAAYVPGYRL
KQEVQFTELDEAESVSTLTGGVDKGPGLWKVSVFLEVEGAAHYLPAYAGNLDIMTSAALQ
VAEKLAEKKDLETAR
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgactctcaccaaagtggccgtcgtcgggtccggcaatatcggcaccgatctggtcatc
aaactcgaaagcatcgccaagaacgtcgagatggccgtcctggttggcatcgatccccag
tccgatgggctcgcacgggcgcgacgattgggcatcagcaccgtggaccgaggcgtccaa
ggtctgatcgaacaccccgagttcgactccatcgacatcatcttcgactcgacgtccgcg
accgcgcacctcgcgaacgaggcggccctgcggcccttcggtaaacggatcatcgacctg
accccggcggccgtaggcccctatgtcgttcccgccgtcaacctgaacgagcatctcgat
gcgcccaacgtcaacatggttacctgcggtgggcaggcaaccatcccgattgtggcggcg
atctctgctgtgacagcagtccactacgccgaaatcgtagcgtccatcgcctcgaaatcc
gcaggaccaggtacccgcgccaacatcgacgaattcaccgaaaccacctctgaagcaatc
gaaaaggtcggcggagcagaacacggcaaagcaatcatcgtgatgaacccggccgagcct
ccgctgatcatgcgcgacaccgtgttggcgctggtgaccaaccccgatcaggatcggatt
cgccggtcagtcgaggacatggtcgcttcggtcgccgcatacgttcctggataccgcctc
aaacaagaagtccagttcaccgaactcgacgaggccgagtcggtctccacgctcaccggc
ggtgtcgacaaaggccctggattgtggaaggtatcggtgttcctcgaggtcgagggtgct
gcgcactacctccctgcatacgcgggaaacctggacatcatgacctctgccgccctgcag
gtcgccgagaaattggcggaaaagaaagatttggagacagcacgatga

DBGET integrated database retrieval system