KEGG   Amycolicicoccus subflavus: AS9A_0171Help
Entry
AS9A_0171         CDS       T01514                                 

Definition
acetaldehyde dehydrogenase 2
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
asd  Amycolicicoccus subflavus
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AS9A_0171
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AS9A_0171
   00650 Butanoate metabolism
    AS9A_0171
  Amino acid metabolism
   00360 Phenylalanine metabolism
    AS9A_0171
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AS9A_0171
   00622 Xylene degradation
    AS9A_0171
   00621 Dioxin degradation
    AS9A_0171
Enzymes [BR:asd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     AS9A_0171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
191568..192515
Genome map
AA seq 315 aa AA seqDB search
MTLTKVAVVGSGNIGTDLVIKLESIAKNVEMAVLVGIDPQSDGLARARRLGISTVDRGVQ
GLIEHPEFDSIDIIFDSTSATAHLANEAALRPFGKRIIDLTPAAVGPYVVPAVNLNEHLD
APNVNMVTCGGQATIPIVAAISAVTAVHYAEIVASIASKSAGPGTRANIDEFTETTSEAI
EKVGGAEHGKAIIVMNPAEPPLIMRDTVLALVTNPDQDRIRRSVEDMVASVAAYVPGYRL
KQEVQFTELDEAESVSTLTGGVDKGPGLWKVSVFLEVEGAAHYLPAYAGNLDIMTSAALQ
VAEKLAEKKDLETAR
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgactctcaccaaagtggccgtcgtcgggtccggcaatatcggcaccgatctggtcatc
aaactcgaaagcatcgccaagaacgtcgagatggccgtcctggttggcatcgatccccag
tccgatgggctcgcacgggcgcgacgattgggcatcagcaccgtggaccgaggcgtccaa
ggtctgatcgaacaccccgagttcgactccatcgacatcatcttcgactcgacgtccgcg
accgcgcacctcgcgaacgaggcggccctgcggcccttcggtaaacggatcatcgacctg
accccggcggccgtaggcccctatgtcgttcccgccgtcaacctgaacgagcatctcgat
gcgcccaacgtcaacatggttacctgcggtgggcaggcaaccatcccgattgtggcggcg
atctctgctgtgacagcagtccactacgccgaaatcgtagcgtccatcgcctcgaaatcc
gcaggaccaggtacccgcgccaacatcgacgaattcaccgaaaccacctctgaagcaatc
gaaaaggtcggcggagcagaacacggcaaagcaatcatcgtgatgaacccggccgagcct
ccgctgatcatgcgcgacaccgtgttggcgctggtgaccaaccccgatcaggatcggatt
cgccggtcagtcgaggacatggtcgcttcggtcgccgcatacgttcctggataccgcctc
aaacaagaagtccagttcaccgaactcgacgaggccgagtcggtctccacgctcaccggc
ggtgtcgacaaaggccctggattgtggaaggtatcggtgttcctcgaggtcgagggtgct
gcgcactacctccctgcatacgcgggaaacctggacatcatgacctctgccgccctgcag
gtcgccgagaaattggcggaaaagaaagatttggagacagcacgatga

DBGET integrated database retrieval system