KEGG   Amycolicicoccus subflavus: AS9A_0222Help
Entry
AS9A_0222         CDS       T01514                                 

Gene name
recR
Definition
recombination protein R
Orthology
K06187  
recombination protein RecR
Organism
asd  Amycolicicoccus subflavus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:asd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    AS9A_0222 (recR)
DNA repair and recombination proteins [BR:asd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      AS9A_0222 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
236369..236989
Genome map
AA seq 206 aa AA seqDB search
MYEGPVQDLIDELGKLPGIGPKSAQRIAFHLLTADRAQIVRLQDALQRIRDGVQFCVVCG
TVAEHEKCRICSDSRRDRTMICVVEEPKDVQAVERTREFKGVYHVLGGALDPLSGVGPDQ
LRIRELLARIGGQVPEGDDAVEVTEVIIATDPNTEGEATATYLVRMLRGFPGLSVTRLAS
GLPMGGDLEFADELTLGRALSGRRAL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgaaggaccagttcaggacctcatcgacgaactgggcaagttgcccgggatcgga
ccgaagagcgcccagcgcatcgcgtttcatctcctcacggcagatcgcgcccagattgtg
cgattgcaggacgcactccagcgcatccgcgatggagtgcagttctgtgttgtgtgcggc
acggtcgcggagcacgagaaatgccggatctgttctgattcgcgccgggaccgcaccatg
atttgtgtcgtggaggagccgaaggatgtccaggcggtcgagcggacgcgcgagttcaag
ggcgtctaccacgtcctcggcggcgcgcttgatccgctttccggggtgggcccggaccaa
ttgcggatccgtgagctcctcgcgcgcatcggggggcaagtgcccgagggtgacgacgcc
gtcgaggtcactgaggtcatcattgcgacagatccgaacaccgaaggcgaagcaacagca
acgtacctagtgcggatgttgcggggcttcccgggtctctccgtgacgcgtctcgcatcg
ggtctgcccatgggtggggacctggagttcgcggacgaactgacgcttggccgggcgcta
tccgggcgccgcgcattgtga

DBGET integrated database retrieval system