KEGG   Amycolicicoccus subflavus: AS9A_0312Help
Entry
AS9A_0312         CDS       T01514                                 

Gene name
folE
Definition
GTP cyclohydrolase 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
asd  Amycolicicoccus subflavus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:asd00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
329838..330467
Genome map
AA seq 209 aa AA seqDB search
MTSIRPEDRIDPEDRIGEVPRVFDQPRAEAAVRELLIAVGEDPSRSGLADTPARVARAYA
ELFAGLHTDPDHVLDTTFDEGHDELVLLKDIPMYSTCEHHLVPFHGVAHVGYIPNESGRV
TGLSKLARLVDLYAKQPQVQERLTSQIADAMMRKLDPRGVIVVVEAEHLCMAMRGIRKPG
ATTTTSAVRGLFKSSAASRSEALDLIIRK
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagcattcgccccgaggaccggattgaccccgaggaccggatcggcgaagtgccg
cgggtttttgatcagccgcgcgctgaagccgcggtgcgggagttgctgatcgctgtcggt
gaggacccctcgcggtcgggcctcgcggacacccccgcgagggtcgcgcgggcgtacgcg
gaactctttgcgggtttgcacacggacccggaccacgttctcgacacgacgttcgacgaa
ggacacgacgaactcgtcctgttgaaggacatacctatgtactccacatgcgagcaccac
ctggtgccttttcacggcgtcgcgcatgttgggtatatcccgaatgagtcggggcgggtc
acgggcctttccaaactcgccagactggttgacctgtatgccaaacagccacaggtgcag
gaacgcctgaccagccagatcgctgatgcgatgatgcgcaagctcgatccgcgcggagtc
atcgtcgtggtggaagctgagcacttgtgcatggcaatgcgaggtatccgcaagcccggt
gccacgaccactacgtcagctgtccgtggcctgttcaagtccagtgcagcgtcccgatcg
gaagcgctcgacctgatcatacggaagtga

DBGET integrated database retrieval system