KEGG   Hoyosella subflava: AS9A_0313Help
Entry
AS9A_0313         CDS       T01514                                 

Definition
(GenBank) Dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
asd  Hoyosella subflava
Pathway
asd00790  Folate biosynthesis
asd01100  Metabolic pathways
Module
asd_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AS9A_0313
Enzymes [BR:asd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     AS9A_0313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AEF38772
UniProt: F6EG70
Position
330476..331354
Genome map
AA seq 292 aa AA seqDB search
MAETASQHPHPGLPAPGRCVVMGIVNVTGDSFSDGGQFLDPERAIARGLELRNLGVDVVD
IGGESTRPGAVRVDPAVEARRVIPVISALTSAGVAVSVDTMRATVAAEAITAGAAIVNDV
SGGQADPDMAKVIADAGVPWILMHWRSNGEYVHRADAGGRDGYRDIVKEVSAELLTQVDA
AVRAGVDPSALVLDPGLGFAKTAEDNWALLQALPHLAGLGFPVLIGASRKRFLGSLLSGP
DGTERAVLERDTATAAISALAVAGGAWGVRVHDARSTLDAIAVAHAWTTGRG
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaccgcatctcagcacccgcaccctggtcttcccgcccctggacgttgcgtc
gtcatgggaatcgtgaacgtcaccggagattcgttttccgatgggggccaattcctggac
cctgaacgtgcgatcgcgcgcggactcgaactgcgtaatctcggcgtggatgttgttgac
atcggcggtgagtcgactcgccccggcgcggtacgggtggaccctgcggtggaggcgcgt
cgtgtcatccccgtcatctccgcactgacgtcggcaggagtggcggtcagcgtcgacacg
atgcgtgcgactgtcgcggctgaggcgatcacggccggggctgccatcgtcaacgatgta
tcgggagggcaggcggatcctgacatggcgaaggtcatcgctgacgccggtgtgccgtgg
atcctcatgcattggcgttcgaacggcgaatacgtccatcgtgccgacgcgggcgggcgc
gacggctatcgcgacattgtcaaagaagtcagcgcggaactcctcacccaggtcgacgct
gccgtgcgcgctggtgtggatccgtctgctctcgtcctcgatccagggctgggattcgcg
aagaccgctgaagacaactgggctctgctccaggccttaccgcatctcgcgggactgggc
ttcccggtgctcatcggggcatcgcgtaaacggttcctcgggtcgctcctctctggcccg
gatggtaccgagcgcgcagtactggagcgtgatacggcaacagcggcgatttcggccctc
gccgttgcgggcggcgcgtggggtgtgcgcgtccatgacgcgcgctcaaccctcgacgct
attgcggtagcacacgcgtggaccactgggcgcggctga

DBGET integrated database retrieval system