KEGG   Amycolicicoccus subflavus: AS9A_0605Help
Entry
AS9A_0605         CDS       T01514                                 

Definition
isocitrate lyase AceA
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
asd  Amycolicicoccus subflavus
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AS9A_0605
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AS9A_0605
Enzymes [BR:asd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     AS9A_0605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
640742..642028
Genome map
AA seq 428 aa AA seqDB search
MSNVGKPRTAAEIQQDWDTNPRWKGINRDYSAEQVAELQGSVVEEHTLARRGAEILWEGV
NSDDYINALGALTGNMAVQQVRAGLKAIYLSGWQVAGDANLSGHTYPDQSLYPANSVPAV
VRRINNALLRADEIARVEGDTAVDNWLVPIVADGEAGFGGALNVYELQKAMIAAGAAGTH
WEDQLASEKKCGHLGGKVLIPTQQHIRTLTSARLAADVSNTETVVIARTDAEAATLITSD
VDERDRPFITGERTAEGFYNIKNGIEPCIARAKAYAPYADMIWMETGVPDLEVAKKFAEA
VKADFPDQLLSYNCSPSFNWRAHLDDSTIAKFQKELGAMGFKFQFITLAGFHALNYSMFD
LAYGYAREGMTAYVDLQEREFASEARGYTATKHQREVGAGYFDRIATTVDPNTSTAALKG
STEEGQFH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtctaacgtcggtaagccacgtaccgccgctgaaattcagcaggactgggacaccaac
cctcgctggaagggaatcaaccgcgactacagcgctgagcaggtcgccgaactgcagggc
agcgtcgtagaagagcacacgctggctcgtcgcggtgcggaaatcctgtgggaaggcgtc
aatagcgacgattacatcaacgctcttggtgcactgaccggcaacatggccgttcagcag
gtccgcgcgggcctgaaggccatctacctgtccggctggcaggtcgccggtgacgcgaac
ctttccggtcacacctaccctgaccagagcctctacccggcaaactcagttccagctgtt
gttcgccgcatcaacaacgcgctgctccgtgccgacgagatcgcgcgcgtcgagggtgac
acggcggttgacaactggctggtgccgatcgtcgctgacggtgaagctggcttcggtggc
gcgctgaacgtctacgagctgcagaaggccatgatcgccgcgggcgcagctggtacccac
tgggaagaccagctcgcgtcggagaagaagtgcggccacctcggtggcaaggtgctgatc
cccacccagcagcacatccgcacgcttacctcggcccgcctcgcagcggacgtttccaac
acagaaaccgtcgtcatcgctcgtaccgacgctgaggccgcgacactcatcacgtctgat
gtcgacgagcgtgaccgcccgttcatcaccggcgagcgcaccgctgagggcttctacaac
atcaagaatggcatcgagccctgcatcgcccgcgcgaaggcttacgcaccgtacgcggac
atgatctggatggagaccggtgttccggacctcgaggtcgcgaagaagttcgccgaggct
gtgaaggctgacttcccagaccagctgctgtcgtacaactgctcaccgtccttcaactgg
cgggcgcacctcgacgactcgacgattgcgaagttccagaaggaactcggcgcgatgggc
ttcaagttccagttcatcacgctcgcgggcttccacgctctcaactacagcatgttcgac
ctggcttacggctatgcccgtgaaggcatgaccgcctacgttgacctgcaggagcgcgag
ttcgcgtcagaggctcgcggctacaccgccaccaagcaccagcgcgaggtcggtgctggc
tacttcgaccgcatcgctaccacggtggatccaaacacctccaccgcagccctcaagggg
tcgactgaagaaggccagttccactga

DBGET integrated database retrieval system