KEGG   Hoyosella subflava: AS9A_0627Help
Entry
AS9A_0627         CDS       T01514                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
asd  Hoyosella subflava
Pathway
asd00010  Glycolysis / Gluconeogenesis
asd00260  Glycine, serine and threonine metabolism
asd00680  Methane metabolism
asd01100  Metabolic pathways
asd01110  Biosynthesis of secondary metabolites
asd01120  Microbial metabolism in diverse environments
asd01130  Biosynthesis of antibiotics
asd01200  Carbon metabolism
asd01230  Biosynthesis of amino acids
Module
asd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
asd_M00002  Glycolysis, core module involving three-carbon compounds
asd_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AS9A_0627 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    AS9A_0627 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AS9A_0627 (gpmA)
Enzymes [BR:asd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     AS9A_0627 (gpmA)
Membrane trafficking [BR:asd04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    AS9A_0627 (gpmA)
Exosome [BR:asd04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   AS9A_0627 (gpmA)
  Exosomal proteins of melanoma cells
   AS9A_0627 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEF39081
UniProt: F6EJN2
Position
663177..663923
Genome map
AA seq 248 aa AA seqDB search
MSIGTLVLLRHGESEWNALNLFTGWVDVHLTEKGVGEGKRAGELLVENEVLPDILYTSLL
RRAISTAHVALDAADRLWIPVVRDWRLNERHYGALQGKNKAQVLAEFGDDQFMLWRRSYS
TPPPPIERGSEYSQDADERYADIDGGPLTECLSDVVTRLIPYWEETIARDLRAGKTVLVA
AHGNSLRALVKHLDEISDEDIAGMNIPTGIPLVYEFSGDDLKPANPGGTYLDPAAAAAGA
AAVAAQGK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcggaacccttgttttgcttcgtcatggtgaaagtgaatggaacgccctcaac
ctcttcacaggctgggtggacgtgcatctcacggaaaaaggcgtcggcgaaggaaaacga
gccggtgagcttctcgtcgagaacgaggtccttcccgacatcctttacacgtctctgctt
cgccgcgcgatcagcaccgcgcatgtcgccctcgacgccgcggaccggctctggattccg
gtagtgcgcgattggcgcctgaacgagcgccactatggcgcgctgcagggtaagaacaag
gcgcaggtgctcgccgaatttggtgacgaccagttcatgctgtggcggcgcagttacagc
acgccgccacccccgattgagcgtggcagcgagtacagccaagacgcggacgagcgctat
gcggatatcgacggcggaccgctgaccgagtgcctgtctgacgtcgtcacaaggctgatt
ccgtactgggaagagaccatcgcgcgtgacttgcgtgccgggaagaccgtcctggttgcg
gcacacgggaactcgctgcgcgccctcgtcaagcatcttgacgagatctcggacgaggac
atcgctgggatgaacatcccgacgggtatcccactcgtgtacgaattcagtggcgacgat
ctcaagccagcgaatcccggtgggacctacctcgacccagcggcagccgcggcaggtgcc
gcagcggtcgcagcccagggcaagtaa

DBGET integrated database retrieval system