KEGG   Amycolicicoccus subflavus: AS9A_0627Help
Entry
AS9A_0627         CDS       T01514                                 

Gene name
gpmA
Definition
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
asd  Amycolicicoccus subflavus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AS9A_0627 (gpmA)
   01230 Biosynthesis of amino acids
    AS9A_0627 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AS9A_0627 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    AS9A_0627 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AS9A_0627 (gpmA)
Enzymes [BR:asd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     AS9A_0627 (gpmA)
Exosome [BR:asd04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   AS9A_0627 (gpmA)
  Exosomal proteins of melanoma cells
   AS9A_0627 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
663177..663923
Genome map
AA seq 248 aa AA seqDB search
MSIGTLVLLRHGESEWNALNLFTGWVDVHLTEKGVGEGKRAGELLVENEVLPDILYTSLL
RRAISTAHVALDAADRLWIPVVRDWRLNERHYGALQGKNKAQVLAEFGDDQFMLWRRSYS
TPPPPIERGSEYSQDADERYADIDGGPLTECLSDVVTRLIPYWEETIARDLRAGKTVLVA
AHGNSLRALVKHLDEISDEDIAGMNIPTGIPLVYEFSGDDLKPANPGGTYLDPAAAAAGA
AAVAAQGK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcggaacccttgttttgcttcgtcatggtgaaagtgaatggaacgccctcaac
ctcttcacaggctgggtggacgtgcatctcacggaaaaaggcgtcggcgaaggaaaacga
gccggtgagcttctcgtcgagaacgaggtccttcccgacatcctttacacgtctctgctt
cgccgcgcgatcagcaccgcgcatgtcgccctcgacgccgcggaccggctctggattccg
gtagtgcgcgattggcgcctgaacgagcgccactatggcgcgctgcagggtaagaacaag
gcgcaggtgctcgccgaatttggtgacgaccagttcatgctgtggcggcgcagttacagc
acgccgccacccccgattgagcgtggcagcgagtacagccaagacgcggacgagcgctat
gcggatatcgacggcggaccgctgaccgagtgcctgtctgacgtcgtcacaaggctgatt
ccgtactgggaagagaccatcgcgcgtgacttgcgtgccgggaagaccgtcctggttgcg
gcacacgggaactcgctgcgcgccctcgtcaagcatcttgacgagatctcggacgaggac
atcgctgggatgaacatcccgacgggtatcccactcgtgtacgaattcagtggcgacgat
ctcaagccagcgaatcccggtgggacctacctcgacccagcggcagccgcggcaggtgcc
gcagcggtcgcagcccagggcaagtaa

DBGET integrated database retrieval system