KEGG   Amycolicicoccus subflavus: AS9A_0679Help
Entry
AS9A_0679         CDS       T01514                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
asd  Amycolicicoccus subflavus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    AS9A_0679
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AS9A_0679
Enzymes [BR:asd01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AS9A_0679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
712355..712852
Genome map
AA seq 165 aa AA seqDB search
MPTTTLQNIPLTTLNGAPASLADFGGRALLIVNVASRCGLTPQYRELEKLATEYADRGLT
VIGLPCNQFGGQEPGTADEIATFCSTTYGVTFPMMEKVEVNGSGRHPLYAELTQTPDDAG
EAGDVQWNFEKFLVAPDGTTVRRFRPRTSPDAPEVIEAIEGILPN
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgccaactacgacgctgcagaacattccgctcacgactcttaacggtgccccggccagt
cttgctgactttggtggccgggcactcctcatcgtcaacgttgcctcacgctgcgggctg
accccccagtaccgggaactcgagaagcttgcgaccgagtacgcggaccgtggcctgacc
gtgattggcctaccgtgcaaccagttcggcgggcaggagcctggcacggcggacgagatc
gccacgttctgttcgacgacctatggcgtgaccttccccatgatggagaaggtcgaggtt
aacggcagcggaaggcatcccttgtacgccgagctcacccaaacacctgatgatgctgga
gaagccggtgacgttcagtggaatttcgagaagttcctcgtggctcctgacggcacgacg
gtgcgccggttccgtccgcgcacctcacctgacgcgccggaagtaatcgaggcgatcgag
gggattttgccgaactga

DBGET integrated database retrieval system