KEGG   Hoyosella subflava: AS9A_0799Help
Entry
AS9A_0799         CDS       T01514                                 

Gene name
fadB
Definition
(GenBank) Fatty oxidation complex alpha subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
asd  Hoyosella subflava
Pathway
asd00071  Fatty acid degradation
asd00280  Valine, leucine and isoleucine degradation
asd00281  Geraniol degradation
asd00310  Lysine degradation
asd00362  Benzoate degradation
asd00380  Tryptophan metabolism
asd00410  beta-Alanine metabolism
asd00640  Propanoate metabolism
asd00650  Butanoate metabolism
asd00903  Limonene and pinene degradation
asd00930  Caprolactam degradation
asd01040  Biosynthesis of unsaturated fatty acids
asd01100  Metabolic pathways
asd01110  Biosynthesis of secondary metabolites
asd01120  Microbial metabolism in diverse environments
asd01130  Biosynthesis of antibiotics
asd01200  Carbon metabolism
asd01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AS9A_0799 (fadB)
   00650 Butanoate metabolism
    AS9A_0799 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    AS9A_0799 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    AS9A_0799 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AS9A_0799 (fadB)
   00310 Lysine degradation
    AS9A_0799 (fadB)
   00380 Tryptophan metabolism
    AS9A_0799 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AS9A_0799 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AS9A_0799 (fadB)
   00281 Geraniol degradation
    AS9A_0799 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AS9A_0799 (fadB)
   00930 Caprolactam degradation
    AS9A_0799 (fadB)
Enzymes [BR:asd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     AS9A_0799 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AS9A_0799 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     AS9A_0799 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 F420_oxidored 2-Hacid_dh_C AlaDh_PNT_C UDPG_MGDP_dh_N NAD_binding_8 DAO GIDA
Motif
Other DBs
NCBI-ProteinID: AEF39251
UniProt: F6EM45
Position
829378..831537
Genome map
AA seq 719 aa AA seqDB search
MSESNLIAWEQDGDGIVTLTMDDPTQGANTMNELFGRSFQETVERLVAEKDTITGVVLTS
AKKTFFAGGNLDDLIKVQPEDAEKVYNQVADLAKGFRALETLGKPVVAAINGAALGGGLE
LALATHYRIAANVKGSQIGLPEVSLGLLPGGGGIVRTVRLLGLQNALMQVLLQGQRHRPE
KAKEIGLVNELVDSIDELVPAAKAWIKANPEAQQPWDVKGFRIPGGTPSNPKFAQMLPAF
PANLRKQIKGAPMPAPRAIMAAAVEGSQVDIDNAAKIEHRYFVELATGQVAKNMTQAFFF
DLQAINNGRSRPDGIERREIKKVGVIGAGMMGAGIAYVSAKAGMDVVLKDVTIEAAEKGK
AYSEAIEAKALSRGKTTEEKSKVLLDRITPSADAADFAGVDFVIEAVFENPDLKNKVFQE
IEDIVDSDAVLGSNTSTLPITGLAQGVKRQEDFIGIHFFSPVDKMPLVEIIKGEKTSDEA
LARVFDYTLAIKKTPIVVNDSRGFFTSRVIGMFINEAIKMLEEGIEPATIEQAGLQAGYP
AAPLQLSDELNFQTMQKIFNETLEAAKAEGKEIDDAAIASGRVIDKMIGEFERTGKSGGA
GFYDYADGKRAGIWPGLRETFKSSPELEVPLKDLSERMMFAEALETVKCFDEGVLMTHAD
ANIGSIFGIGFPAWTGGVIQFIKGYEGGVDGFIKRSEELAAKYGNRFTPHPRLKEIVTK
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaagcaacttgattgcgtgggagcaggacggcgacggcatcgtcacgctcacc
atggatgaccccacccagggcgccaacacgatgaacgagctcttcggccgctccttccag
gagaccgttgagcgcctggtcgcagagaaggacaccatcaccggtgttgtcctgacctct
gccaagaagacgtttttcgcgggcggcaaccttgacgacctgatcaaggtgcagccagag
gacgccgagaaggtttacaaccaggttgctgacctggcgaaaggcttccgtgctctcgaa
actctcggcaagccagtagttgcggcgatcaacggcgcggcactcggtggcggcctggag
ctggcgctcgcgacgcactaccgcatcgcggccaacgtcaagggctcgcagatcggtctg
cctgaggtgtcgctcggtctgctgccaggtggcggcggcatcgtccgcactgtccggctg
ctcggcctgcagaacgcgctgatgcaggtgctcctgcaggggcagcgtcaccgtccggag
aaggcgaaagagatcggcctcgtcaacgaacttgtcgattccatcgacgagctggtgccg
gccgcgaaggcctggatcaaggccaaccctgaggcgcagcagccgtgggacgtcaagggc
ttccggatccccggcggcaccccgtcgaacccgaagttcgcgcagatgctcccggcgttc
cccgcgaacctgcgcaagcagatcaagggtgccccgatgcctgctccgcgcgcgatcatg
gcagcggcagtagagggctcgcaggtcgatatcgacaatgcggcgaagatcgagcaccgc
tacttcgtggaacttgccaccgggcaggtcgcgaagaacatgacgcaggctttcttcttc
gacctgcaagccatcaacaatggtcgttcgcgcccagatggtatcgagcggcgtgagatc
aagaaggtcggtgttatcggtgccggcatgatgggtgccggtatcgcttacgtttccgcc
aaggccggtatggatgtcgtcctcaaggacgtcaccatcgaagccgcagaaaagggcaag
gcgtactccgaagcgattgaggctaaggcgctttcccgcggcaagaccacggaagagaag
tcgaaggtgctgctcgaccggatcacgcccagtgctgatgccgccgacttcgctggcgtc
gacttcgttatcgaagccgtgttcgagaaccctgatctgaagaacaaggtcttccaggaa
atcgaggacatcgtcgattcggacgccgtcctcggatccaacacgtcgacacttccgatc
acgggcctggctcagggtgtgaagcgtcaggaagacttcatcggcatccacttcttctcg
cctgtggacaagatgccgctggtcgagatcatcaagggtgaaaagacgtcagacgaggcg
ctggcccgcgtgttcgactacaccctcgcgatcaagaagaccccgatcgtggtgaacgac
agccgcggcttcttcacgtcgcgcgtcatcggtatgttcatcaacgaagccatcaagatg
cttgaagagggcatcgagcccgcaacgatcgagcaggcagggctgcaggccggttacccg
gctgcaccattgcaactgtccgatgagctgaacttccagacgatgcagaagatcttcaac
gagaccctggaggccgctaaggctgagggtaaagagatcgatgacgctgcaatcgcatcc
ggccgggttatcgacaagatgatcggcgagttcgagcgcaccggcaagtccggcggcgct
ggcttctatgactatgcggacggcaagcgggccggcatctggccgggtctccgcgagacg
tttaagtcgtcgccagaacttgaagttccgctcaaggatctgagcgagcgcatgatgttc
gctgaggcgctcgagacagtgaagtgcttcgacgagggcgtcctgatgacgcacgcagac
gccaacatcggttcgatctttggcattggcttccccgcctggaccggtggtgtcatccag
ttcatcaagggctacgagggtggcgttgacggcttcatcaagcgctctgaggagctagcc
gccaagtacggcaaccgattcaccccgcacccccgcctgaaggagatcgtcactaagtag

DBGET integrated database retrieval system