KEGG   Amycolicicoccus subflavus: AS9A_0799Help
Entry
AS9A_0799         CDS       T01514                                 

Gene name
fadB
Definition
fatty oxidation complex subunit alpha
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
asd  Amycolicicoccus subflavus
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AS9A_0799 (fadB)
   01212 Fatty acid metabolism
    AS9A_0799 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AS9A_0799 (fadB)
   00650 Butanoate metabolism
    AS9A_0799 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    AS9A_0799 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    AS9A_0799 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AS9A_0799 (fadB)
   00310 Lysine degradation
    AS9A_0799 (fadB)
   00380 Tryptophan metabolism
    AS9A_0799 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AS9A_0799 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AS9A_0799 (fadB)
   00281 Geraniol degradation
    AS9A_0799 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    AS9A_0799 (fadB)
Enzymes [BR:asd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     AS9A_0799 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AS9A_0799 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     AS9A_0799 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
829378..831537
Genome map
AA seq 719 aa AA seqDB search
MSESNLIAWEQDGDGIVTLTMDDPTQGANTMNELFGRSFQETVERLVAEKDTITGVVLTS
AKKTFFAGGNLDDLIKVQPEDAEKVYNQVADLAKGFRALETLGKPVVAAINGAALGGGLE
LALATHYRIAANVKGSQIGLPEVSLGLLPGGGGIVRTVRLLGLQNALMQVLLQGQRHRPE
KAKEIGLVNELVDSIDELVPAAKAWIKANPEAQQPWDVKGFRIPGGTPSNPKFAQMLPAF
PANLRKQIKGAPMPAPRAIMAAAVEGSQVDIDNAAKIEHRYFVELATGQVAKNMTQAFFF
DLQAINNGRSRPDGIERREIKKVGVIGAGMMGAGIAYVSAKAGMDVVLKDVTIEAAEKGK
AYSEAIEAKALSRGKTTEEKSKVLLDRITPSADAADFAGVDFVIEAVFENPDLKNKVFQE
IEDIVDSDAVLGSNTSTLPITGLAQGVKRQEDFIGIHFFSPVDKMPLVEIIKGEKTSDEA
LARVFDYTLAIKKTPIVVNDSRGFFTSRVIGMFINEAIKMLEEGIEPATIEQAGLQAGYP
AAPLQLSDELNFQTMQKIFNETLEAAKAEGKEIDDAAIASGRVIDKMIGEFERTGKSGGA
GFYDYADGKRAGIWPGLRETFKSSPELEVPLKDLSERMMFAEALETVKCFDEGVLMTHAD
ANIGSIFGIGFPAWTGGVIQFIKGYEGGVDGFIKRSEELAAKYGNRFTPHPRLKEIVTK
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaagcaacttgattgcgtgggagcaggacggcgacggcatcgtcacgctcacc
atggatgaccccacccagggcgccaacacgatgaacgagctcttcggccgctccttccag
gagaccgttgagcgcctggtcgcagagaaggacaccatcaccggtgttgtcctgacctct
gccaagaagacgtttttcgcgggcggcaaccttgacgacctgatcaaggtgcagccagag
gacgccgagaaggtttacaaccaggttgctgacctggcgaaaggcttccgtgctctcgaa
actctcggcaagccagtagttgcggcgatcaacggcgcggcactcggtggcggcctggag
ctggcgctcgcgacgcactaccgcatcgcggccaacgtcaagggctcgcagatcggtctg
cctgaggtgtcgctcggtctgctgccaggtggcggcggcatcgtccgcactgtccggctg
ctcggcctgcagaacgcgctgatgcaggtgctcctgcaggggcagcgtcaccgtccggag
aaggcgaaagagatcggcctcgtcaacgaacttgtcgattccatcgacgagctggtgccg
gccgcgaaggcctggatcaaggccaaccctgaggcgcagcagccgtgggacgtcaagggc
ttccggatccccggcggcaccccgtcgaacccgaagttcgcgcagatgctcccggcgttc
cccgcgaacctgcgcaagcagatcaagggtgccccgatgcctgctccgcgcgcgatcatg
gcagcggcagtagagggctcgcaggtcgatatcgacaatgcggcgaagatcgagcaccgc
tacttcgtggaacttgccaccgggcaggtcgcgaagaacatgacgcaggctttcttcttc
gacctgcaagccatcaacaatggtcgttcgcgcccagatggtatcgagcggcgtgagatc
aagaaggtcggtgttatcggtgccggcatgatgggtgccggtatcgcttacgtttccgcc
aaggccggtatggatgtcgtcctcaaggacgtcaccatcgaagccgcagaaaagggcaag
gcgtactccgaagcgattgaggctaaggcgctttcccgcggcaagaccacggaagagaag
tcgaaggtgctgctcgaccggatcacgcccagtgctgatgccgccgacttcgctggcgtc
gacttcgttatcgaagccgtgttcgagaaccctgatctgaagaacaaggtcttccaggaa
atcgaggacatcgtcgattcggacgccgtcctcggatccaacacgtcgacacttccgatc
acgggcctggctcagggtgtgaagcgtcaggaagacttcatcggcatccacttcttctcg
cctgtggacaagatgccgctggtcgagatcatcaagggtgaaaagacgtcagacgaggcg
ctggcccgcgtgttcgactacaccctcgcgatcaagaagaccccgatcgtggtgaacgac
agccgcggcttcttcacgtcgcgcgtcatcggtatgttcatcaacgaagccatcaagatg
cttgaagagggcatcgagcccgcaacgatcgagcaggcagggctgcaggccggttacccg
gctgcaccattgcaactgtccgatgagctgaacttccagacgatgcagaagatcttcaac
gagaccctggaggccgctaaggctgagggtaaagagatcgatgacgctgcaatcgcatcc
ggccgggttatcgacaagatgatcggcgagttcgagcgcaccggcaagtccggcggcgct
ggcttctatgactatgcggacggcaagcgggccggcatctggccgggtctccgcgagacg
tttaagtcgtcgccagaacttgaagttccgctcaaggatctgagcgagcgcatgatgttc
gctgaggcgctcgagacagtgaagtgcttcgacgagggcgtcctgatgacgcacgcagac
gccaacatcggttcgatctttggcattggcttccccgcctggaccggtggtgtcatccag
ttcatcaagggctacgagggtggcgttgacggcttcatcaagcgctctgaggagctagcc
gccaagtacggcaaccgattcaccccgcacccccgcctgaaggagatcgtcactaagtag

DBGET integrated database retrieval system