KEGG   Amycolicicoccus subflavus: AS9A_0948Help
Entry
AS9A_0948         CDS       T01514                                 

Definition
(GenBank) Acetyl-CoA C-acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
asd  Amycolicicoccus subflavus
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AS9A_0948
   00630 Glyoxylate and dicarboxylate metabolism
    AS9A_0948
   00640 Propanoate metabolism
    AS9A_0948
   00650 Butanoate metabolism
    AS9A_0948
  Lipid metabolism
   00071 Fatty acid degradation
    AS9A_0948
   00072 Synthesis and degradation of ketone bodies
    AS9A_0948
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AS9A_0948
   00310 Lysine degradation
    AS9A_0948
   00380 Tryptophan metabolism
    AS9A_0948
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AS9A_0948
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AS9A_0948
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AS9A_0948
Enzymes [BR:asd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AS9A_0948
Exosome [BR:asd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AS9A_0948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
974722..975873
Genome map
AA seq 383 aa AA seqDB search
MAEALIIDAVRTPVGKRGGGLSAVHSADLGAHILSSLVKRAGIDPETVDDVIMGCTDTLG
SQAGNIARTSWLAAGLPEHVPGVTVDRQCGSSQQAIHFAAQAVMSGTADAVVASGVQNMS
QIPISAAMLAGREYGFDDPFTGSKGWVERYGSGVVSQFESADMIARHWDITRERMEEFAL
ASHERALDAIDSGRFEAELAPLGDCTLDECPRRGTTLERMASLKPLSESSRLTAAVASQI
CDGAAATLVVSEDYAAKHGLHPRARIHHISVRAADPVWMLTGPIPATQVALRKAGLTIED
IDLFEVNEAFASVALAWIDELGADPTRVNVNGGGIALGHPIGATGAKLFTTLLHELERRG
GRYGLQTMCEGGGTANVTIIERV
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagctctcatcatcgacgccgtacgcaccccggtcgggaagcgtggaggaggg
ctcagcgcagtacattccgccgatctcggggcacatatcttgtcgtcgctcgtcaagcgc
gcgggtatcgaccccgaaaccgtcgacgacgtcatcatggggtgcactgacacacttggt
tctcaggctggaaatatcgcccgtacatcgtggctggcggcaggtctgccggaacacgta
ccgggtgtaactgtggatcggcagtgtggctccagtcagcaggccattcacttcgcggcg
caagcggtgatgtccggtaccgcggatgccgtcgtcgcgtctggtgtgcagaacatgagt
cagatcccgatcagtgcggcgatgctcgccgggcgggagtatggcttcgatgatccgttc
accggctccaaaggctgggttgagcggtacggatcgggcgtcgtatcccagtttgagagc
gcggacatgatcgcgcgacattgggacatcacccgggaacggatggaagagttcgcgctt
gcgagccacgagcgcgcgctagacgcgattgattccggccggttcgaggctgagctcgcc
ccgctcggcgactgcactctcgatgaatgtccgcgtcgtggaactactctggagagaatg
gcttcgctaaagcccctcagcgaaagctcccggctgaccgccgcagtggccagccagatt
tgtgatggcgccgccgccacactcgttgtttctgaagactatgccgctaagcacggattg
cacccccgggcccggattcaccacatttcagtgcgtgccgccgaccctgtctggatgctg
accggacccatccccgcgacacaagtcgcgctgcgcaaggccggtctcaccattgaggac
attgatctgttcgaagtcaacgaagcgtttgccagcgtcgccctcgcctggattgacgaa
ctcggcgcggatcccacccgtgtgaacgtcaatggcggcggaatcgcgctcgggcaccct
atcggtgcgacaggcgcgaagcttttcaccacgctgctgcatgaactcgagcgtcgcggt
ggccgctacggtctgcagactatgtgcgaaggtggcgggaccgcgaacgtcacgatcatt
gagcgggtttag

DBGET integrated database retrieval system