KEGG   Amycolicicoccus subflavus: AS9A_1126Help
Entry
AS9A_1126         CDS       T01514                                 

Gene name
proB
Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
asd  Amycolicicoccus subflavus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:asd01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:asd00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1170947..1172050
Genome map
AA seq 367 aa AA seqDB search
MSVRESIASARRIVVKIGSSAITTLEGGLELDRLNALVDACEARMRAGSDVVVVSSGAVG
AGISPLGLKKRPQDLATKQAAASVGQLAMAQAWSTSFARHNRVVGQVLLTADDIARRAQH
RNAQRTLDRLRSLRAVAVVNENDTVATTELRFGDNDRLAALVAHLVGADALVLLSDVDGL
YDGDPRKGGATIIREVAGPDDLDGVVAGTGGALGTGGMASKLSAARLAADSGVPVLLAAA
ADADSALSTAAVGTVFAARPGRMSARKFWVRHAADTNGSLQLDDGAVAAVVGKRRSLLAA
GITRIEGRFYGGDVVDIIDKDGAKVARGVVAFDSSELSAMLGRSSTDLPAELRRPVIHAD
DLVAHLR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtccgggagtccatagcgagcgcccgtcgcatcgttgtcaagatcggctcttcc
gctatcacgaccctcgagggtggccttgaacttgaccggctcaatgcgctcgtggacgcc
tgtgaggcgcggatgcgcgccgggtccgacgttgttgtcgtctcctcaggcgcggtaggc
gcggggatttcgccgctaggtctgaagaaacgtccacaagacctcgccaccaaacaggcc
gccgccagtgtggggcagcttgccatggcgcaagcgtggtccacctccttcgcccggcac
aatcgggtcgtgggccaggtgctgctcaccgctgatgacatcgcacgtcgtgcccagcac
cggaatgcccagcgaacactcgaccgcttgcgttcgctgcgcgccgtggcggtcgtcaat
gagaacgacactgtcgctacgacggagttgaggttcggcgataacgaccgcttggctgct
ctcgtcgcgcacctagtcggtgctgacgcgctggttctcctgtctgatgtggacggactt
tacgacggagacccgcgcaaagggggtgccacaatcattcgcgaggtcgctggaccggac
gacctcgacggcgtggtcgccgggactgggggagcgctcggtaccggtggaatggcatcc
aaactgtccgccgctcgtctcgcggcggactcaggggttcccgtgctgcttgccgcggct
gcggacgcggacagcgcgctgtccactgctgctgtaggcactgtgttcgcagcccggccc
gggcgaatgtcagcgcggaagttctgggtgcgccatgcggccgacaccaacggcagtctg
cagctcgatgatggtgcggtggcagcggtggtcggcaaacgccgctccttgctcgccgct
ggcatcactcgaatcgagggccgattctatggcggcgatgtcgtggacatcatcgacaaa
gatggcgcgaaggtggcgcggggtgtcgtcgcatttgattcgtcggaattgtccgcgatg
ctcggccggtccagcactgatcttccggccgagctgcgccgtcccgttatccacgcggac
gacctggtagcacacttgcgctga

DBGET integrated database retrieval system