KEGG   Hoyosella subflava: AS9A_1126Help
Entry
AS9A_1126         CDS       T01514                                 

Gene name
proB
Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
asd  Hoyosella subflava
Pathway
asd00330  Arginine and proline metabolism
asd00332  Carbapenem biosynthesis
asd01100  Metabolic pathways
asd01130  Biosynthesis of antibiotics
asd01230  Biosynthesis of amino acids
Module
asd_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AS9A_1126 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    AS9A_1126 (proB)
Enzymes [BR:asd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     AS9A_1126 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AEF39578
UniProt: F6EQW7
Position
1170947..1172050
Genome map
AA seq 367 aa AA seqDB search
MSVRESIASARRIVVKIGSSAITTLEGGLELDRLNALVDACEARMRAGSDVVVVSSGAVG
AGISPLGLKKRPQDLATKQAAASVGQLAMAQAWSTSFARHNRVVGQVLLTADDIARRAQH
RNAQRTLDRLRSLRAVAVVNENDTVATTELRFGDNDRLAALVAHLVGADALVLLSDVDGL
YDGDPRKGGATIIREVAGPDDLDGVVAGTGGALGTGGMASKLSAARLAADSGVPVLLAAA
ADADSALSTAAVGTVFAARPGRMSARKFWVRHAADTNGSLQLDDGAVAAVVGKRRSLLAA
GITRIEGRFYGGDVVDIIDKDGAKVARGVVAFDSSELSAMLGRSSTDLPAELRRPVIHAD
DLVAHLR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtccgggagtccatagcgagcgcccgtcgcatcgttgtcaagatcggctcttcc
gctatcacgaccctcgagggtggccttgaacttgaccggctcaatgcgctcgtggacgcc
tgtgaggcgcggatgcgcgccgggtccgacgttgttgtcgtctcctcaggcgcggtaggc
gcggggatttcgccgctaggtctgaagaaacgtccacaagacctcgccaccaaacaggcc
gccgccagtgtggggcagcttgccatggcgcaagcgtggtccacctccttcgcccggcac
aatcgggtcgtgggccaggtgctgctcaccgctgatgacatcgcacgtcgtgcccagcac
cggaatgcccagcgaacactcgaccgcttgcgttcgctgcgcgccgtggcggtcgtcaat
gagaacgacactgtcgctacgacggagttgaggttcggcgataacgaccgcttggctgct
ctcgtcgcgcacctagtcggtgctgacgcgctggttctcctgtctgatgtggacggactt
tacgacggagacccgcgcaaagggggtgccacaatcattcgcgaggtcgctggaccggac
gacctcgacggcgtggtcgccgggactgggggagcgctcggtaccggtggaatggcatcc
aaactgtccgccgctcgtctcgcggcggactcaggggttcccgtgctgcttgccgcggct
gcggacgcggacagcgcgctgtccactgctgctgtaggcactgtgttcgcagcccggccc
gggcgaatgtcagcgcggaagttctgggtgcgccatgcggccgacaccaacggcagtctg
cagctcgatgatggtgcggtggcagcggtggtcggcaaacgccgctccttgctcgccgct
ggcatcactcgaatcgagggccgattctatggcggcgatgtcgtggacatcatcgacaaa
gatggcgcgaaggtggcgcggggtgtcgtcgcatttgattcgtcggaattgtccgcgatg
ctcggccggtccagcactgatcttccggccgagctgcgccgtcccgttatccacgcggac
gacctggtagcacacttgcgctga

DBGET integrated database retrieval system