KEGG   Amycolicicoccus subflavus: AS9A_1134Help
Entry
AS9A_1134         CDS       T01514                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
asd  Amycolicicoccus subflavus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AS9A_1134 (rbsK)
Enzymes [BR:asd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     AS9A_1134 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1177609..1178478)
Genome map
AA seq 289 aa AA seqDB search
MDMSRIAVLGSINMDLVVRAQRLPAPGETVLGESRREIPGGKGANQAIAAARMGAHVWFL
GAVGTDSYAQPLREHLLSAGVHTSELRTTAGPSGFASITVNQEGENAIVVVPGANQSLHG
LTPADRARIRDCDVVLLQLELPIDVVAEAAEFACMAGTTVMLNPSPYQQLPERLLTHADV
VILNEIEAEQLGRDQAGLRQLLITRGRRGAHFRGRGGESFDVPALGVDVIDTTGAGDAFA
GACAALWHRGASVAVPWACTAGALAVTREGAYSPEYAEVAERMPSLRES
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
gtggacatgagccggattgcggttctcggcagcatcaacatggaccttgtcgtgcgggcg
cagcgcttgcctgcacctggagaaacggttctcggtgagtcacggcgagagatccccggc
ggcaagggcgccaaccaggccatcgcggccgcccgcatgggtgcgcacgtctggtttctc
ggagcggtgggaactgacagctatgcacagccccttcgggaacacctgctgtcggctggt
gtgcacacatcggagctacgcaccaccgcgggcccaagtggtttcgcgtcgatcacggtg
aaccaggagggtgagaatgcaatcgtcgtcgtccccggcgcaaatcagtcgctccatgga
cttacgcctgcagaccgggcacgtatccgcgactgtgatgtcgtactgctccagctcgag
ttaccgattgacgtcgtcgccgaggccgccgagttcgcgtgcatggcaggcacaaccgtg
atgctcaacccttcgccctatcagcaactccccgagcgtctgctcacccatgcagacgta
gtgatcctcaacgagattgaggctgaacaactcggacgcgaccaggctgggttgcgtcag
ctcctcatcacccgagggcgacgcggtgcgcactttcgcggtcgtggaggcgaaagcttc
gacgtacccgccctgggggtagacgttatcgacaccacgggggcaggagacgcgttcgcg
ggcgcctgcgcagcactctggcaccgcggcgcatccgtcgctgtgccgtgggcctgcacg
gccggtgcactcgcagtaactcgagagggagcgtacagtccggaatatgccgaggtggcg
gaaagaatgcctagcctgcgcgagagctag

DBGET integrated database retrieval system