KEGG   Amycolicicoccus subflavus: AS9A_1262Help
Entry
AS9A_1262         CDS       T01514                                 

Definition
(RefSeq) dihydrolipoamide acyltransferase
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
asd  Amycolicicoccus subflavus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AS9A_1262
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AS9A_1262
  Amino acid metabolism
   00310 Lysine degradation
    AS9A_1262
Enzymes [BR:asd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AS9A_1262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1309505..1311316)
Genome map
AA seq 603 aa AA seqDB search
MAFSVQMPALGESVSEGTVTRWLKQEGDTVEVDEPLLEVSTDKVDTEIPSPAAGVLSKII
ANEDDVVEIGGELAVISEDGETDESDSGGDDESSADESSTDEADTDEASSEESDSEPADA
DELAEKSEETEDSPAQEEESTGDSSGTQVTMPALGESVTEGTVTRWLKAVGDEVEMDEPL
LEVSTDKVDTEIPSPVAGTLLEITAEEDEVVEVGGQLAVIGSGKPEPSEKKSEKKAEPEP
EPEPEPEPEPEPEPKAESKSKPEKKPEPKAESKSKPEKKPEPKAESKPASGATPYVTPLV
RKLASEHKIDLSTIEGSGVGGRIRKEDVLAAAESAKSTKDKAPATSGEKKDRTPAGVRPE
LAELRGTVQKANRIRQITAVKTRESLQTTAQLTQTHEVDLTRVAALRAANKSAFKDRHGV
NLTFLPFFAKAVVEALKLHPNINASYDEDAKEITYHGSEHLGIAVDTPNGLLSPVIHNAG
DMSIAELAQAINDIASRARTGGLKPDELTGGTFTVTNIGSNGALFDTPILVPPQAAMLGT
GAIVKRPIVARDADGNDVIAIRSMAFLPLTYDHRLVDGADAGRFLTTIKQRLEEGEFEGD
LDL
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgttcaaatgcccgccctaggtgaaagcgtgagtgagggaaccgtcacg
cgatggctcaagcaagaaggcgataccgtcgaggtcgacgagcccttacttgaggtctcc
accgataaagttgacaccgaaattccttcgcctgcggctggcgttctgagcaagatcatc
gcaaacgaggacgacgtcgtagagatcggcggtgaactcgccgtcatcagtgaagatggc
gaaaccgacgagagcgactccggtggtgacgacgagtccagcgccgatgagtccagcacc
gacgaagccgacaccgacgaagccagctccgaggagtccgattccgagcctgccgacgca
gatgaactcgccgagaagtcggaagaaaccgaagactcccctgcccaggaggaagaatca
accggggattcctcgggaactcaggtcactatgcccgctctcggtgagtcagtcaccgag
gggacagtcactcgatggctgaaagctgtcggggacgaagtcgagatggacgagccgctt
ctcgaggtttcgacagacaaggtcgacaccgagattccctcgccagttgctggcacgcta
ctcgagatcacagccgaggaagacgaggttgtcgaggtcggtggccagctcgcggtgatc
ggcagtggcaagcctgagccgagcgagaagaaatcagaaaagaaggccgaacccgagccg
gagcccgagcccgagcccgagcccgagcccgagccggagccgaaggcagaatcaaagtcc
aagccggagaagaagccggagccgaaggcagaatcaaagtccaagccggaaaagaagccc
gagccgaaggcagagtcaaagcccgcttccggggcaacgccgtacgtcacgccactcgtg
cgaaagctcgcttcggaacacaagattgacctttcgactatcgagggctccggggtaggc
ggccgtatccgcaaggaagacgtacttgccgcggcggaatctgctaagtcaacgaaagac
aaggcgcctgctacttccggagagaagaaagatcgcaccccggcaggggtccgccctgaa
ctcgcagaactgcgtggcacggtacagaaggccaaccgaatccgtcagatcactgcggta
aagacccgtgagtcgctccagacaacagctcagctgacgcagacccacgaagtcgatctg
acccgcgtcgcagcgctgcgcgcagcgaataagtcagcgttcaaggatcgccacggagtc
aacctgactttcctgccgttcttcgcgaaagctgtggtcgaagcactcaagcttcatccg
aacatcaacgcgagttacgacgaggatgccaaggagatcacctaccacggcagcgaacac
ctcggaatcgcggtcgacacgccgaacggtctgctctcgccggtcatccacaatgcgggc
gacatgtctatcgcagaactggctcaagcgatcaacgacatcgcatcccgggcgcggacc
gggggcctgaagccagacgaactcaccggcggcacgtttactgtcacaaatatcggcagc
aacggagcgctattcgatacaccgatcctcgttccgccacaagcggcgatgctgggtacc
ggtgcaatcgtcaagcgtccgatcgttgcccgtgatgccgatggaaacgacgtgatcgcc
attcgctcgatggcgttcctgccgctgacatacgatcatcgtcttgttgacggcgccgac
gcgggccggttcttgacaacgatcaagcagcggctcgaagaaggcgagttcgagggcgac
ctcgacctctga

DBGET integrated database retrieval system