KEGG   Amycolicicoccus subflavus: AS9A_1343Help
Entry
AS9A_1343         CDS       T01514                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
asd  Amycolicicoccus subflavus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AS9A_1343
Enzymes [BR:asd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     AS9A_1343
Exosome [BR:asd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AS9A_1343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1397927..1400131
Genome map
AA seq 734 aa AA seqDB search
MMSSISERHSEAGHWPAAEEIHALAVGAHSNPHGMLGAHPHESGRAVVRVYRPEAAAVTV
ISDGQKYPLSRGDEGLFSGFAGETVGDYKLEVTYHGRTSVLDDPYRWLPTLGELDLHLVG
EGRHERLWDVLGARPISYDTPSGEVAGVAFSVWAPNARGVRVCGDFDGWSGVEHSMRSLG
SSGIWELFIPGIGAGTKYKFRLHGADGGWHEKADPMAVCAEHPPATASVIYESDYTWTDS
TWFAQRDSVSPVNTPVSIYEVHLGSWRPGLGYREAAKELADYVTEMGFTHVEFLPLAEHP
FGGSWGYQVTSYYAPTSRFGSPDDLRYFVDTLHNQGIGVILDWVPAHFPRDTWALARFDG
SALYEHPDPRKGEQPDWGTYVFDFGRPEVRNFLVANALYWFSEFHIDGLRVDAVASMLYL
DYSRKEGEWIPNERGGRENLDAMRFIQELNATVYKHHPGVMMIAEESTSWPGVTQPTNSD
GLGFGFKWNMGWMNDTLAYIGRDPIHRTYHHNDLTFSLVYAWSENFILPLSHDEVVHGKG
SLFTRMPGDHWKKAAGLRALLAYMWAHPGKQLLFMGGELGQQREWSHEGSIDWHLLEDPL
HAGIKSCVAHLNRTYRSARALYAGDNTAEGFRWIDADDSTRSILSFVRMDPVNPENRPLV
CIANFSGIPHNDVRVGLPATGTWREAVNTDSTDYGGSGVGNMGSVEATGEPWNGLPASAV
VQVPPLGVLWLMPA
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcgtcgatatccgaacgtcactcagaggccggccattggccggcagcagaggag
atccacgcgctcgcagtgggcgcccacagcaaccctcatgggatgctgggcgcgcacccg
cacgaatcgggacgcgctgtagttcgcgtgtaccggccagaggccgcagccgtaacggtg
ataagcgacggtcagaagtatccactttcacgcggcgatgagggcttgttcagcggcttc
gccggcgagacagtcggggactataagctcgaggtcacctaccacggccgcacgtccgta
ctcgatgatccttaccgctggctccccacacttggggagctcgatttgcacctagtcggt
gagggccgccatgaacgcctttgggacgtgctcggcgcgcggccaattagctacgacacg
ccatcgggtgaggtcgcgggcgtcgcattctcggtgtgggctcctaacgcacgcggcgta
cgggtctgcggggatttcgacggctggtccggtgttgagcattcgatgcgctcgctgggc
agctccgggatctgggagctgttcatcccgggcatcggcgccggaacgaaatacaagttc
cggctccacggcgctgacggtggatggcacgagaaagccgaccctatggcggtgtgcgct
gagcacccacccgcgactgcgtcggtgatctacgaatcggactacacgtggactgattcc
acgtggtttgcacagcgcgattccgtgagccccgtgaacacaccggtcagcatctatgag
gtgcatctgggttcctggaggccaggtctcggctaccgcgaagccgcgaaggaactcgcc
gactacgtcaccgaaatgggcttcacccacgtcgagtttctgcccctcgccgagcatcca
tttggtggctcatggggataccaggtcacgtcatactatgccccgacgtcacgcttcggt
tctccggacgacctgcggtatttcgttgacaccctgcacaatcagggcattggtgtcatc
ctggactgggttccagcgcatttccctcgtgatacctgggcgctcgctcggttcgacggc
agcgcgctatacgagcaccccgatccccgaaaaggcgaacagcccgactggggcacgtat
gttttcgacttcggccggcccgaagtgcgcaacttcctggttgccaatgcgctgtactgg
ttcagcgaattccatatcgatggactgcgcgtcgacgctgtcgcgtcgatgctctacctc
gactactcgcgcaaggaaggcgagtggatcccgaatgagcgtggtggccgcgaaaacctc
gacgcgatgcggttcattcaagaactcaacgcaacggtgtacaagcaccatcctggcgtg
atgatgattgccgaggagtcgacatcatggcctggtgtcacacagcccactaactcggat
ggcctcggattcggattcaaatggaatatgggctggatgaacgacacgctcgcctacata
gggcgcgatccgatacatcgcacctaccaccacaatgatctgacgttttcgttggtgtat
gcgtggagcgagaacttcatactgccgctatcccacgacgaggtcgttcatggcaaaggt
tcgctctttacgaggatgccaggtgaccactggaagaaggctgctgggctgcgcgctctg
ctcgcatacatgtgggcccatccagggaagcagttgctcttcatgggtggggagctaggc
cagcagcgcgaatggtcacatgagggatcaatcgactggcacctgctcgaggaccctttg
cacgcagggatcaagagctgtgtcgcgcatttgaaccgcacttatcgatcagcacgcgcg
ctgtacgcgggggacaacaccgcggagggctttcgctggatcgacgccgacgattccacg
cgcagcatcctcagcttcgttcgcatggacccggtgaatcccgagaaccggccactcgtg
tgtatcgcgaacttctcgggaattccgcataacgacgtccgcgtcggacttccggccacg
ggaacgtggcgtgaagcagtgaacaccgactcgaccgactatggcggatcaggtgtgggc
aacatgggatctgtggaggcgaccggtgagccctggaacgggttgcctgcctcagcggtg
gtccaggtgcctccgctaggggtgctctggctcatgcccgcctag

DBGET integrated database retrieval system