KEGG   Amycolicicoccus subflavus: AS9A_1374Help
Entry
AS9A_1374         CDS       T01514                                 

Definition
putative guanidinobutyrase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
asd  Amycolicicoccus subflavus
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AS9A_1374
Enzymes [BR:asd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     AS9A_1374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1430294..1431283)
Genome map
AA seq 329 aa AA seqDB search
MDPADEVPRARDNGNVGQVDATRKPRFAEPTTFARLPRLDEVSRADVTILGVPFDSGVSY
RPGARFGPNHIRAASKLLRPYHPGLDVHPFAAQQVADFGDLGVNPFDINDALVAVQSAVT
DLRRDGSTVLTLGGDHTIALPLLRALHRDHGKVAVLHFDAHLDTWDTYFGARYTHGTPFR
RASEEGLIDMERSQHIGIRGPLYSKKDLEDDDMLGFQIVRSDDYQTDGVASIIDRMRRRL
GTSADGPVYVSIDIDVLDPAFAPGTGTPEAGGLTSRELLQTLRGLTDMNIVGADIVEVAP
AYDHAEITGIAAAHVAYELLSVLALNRPR
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggaccccgcagacgaagttccgcgcgctcgcgacaacggaaacgtcggtcaggtggac
gcgacccgtaaaccgcgcttcgctgaaccgactacctttgctcgcctcccccgactcgat
gaagtctcgcgagcggacgtcacaattctcggtgtccccttcgattccggtgtgagttac
cgtcctggtgcccggttcggtccgaatcacatccgggcagcgtctaagctcttacgccct
taccaccctggcctggacgttcatcctttcgcggcgcagcaggtggctgacttcggcgat
ctcggggtgaacccgttcgacatcaacgacgcactcgtggctgttcagtcggcagtcact
gatttgcgccgcgacggatcaacagtgctcaccctcggcggcgatcacacaatcgcattg
cccctccttcgcgctctgcatcgtgaccacggcaaggtcgcagtcctccatttcgacgcg
cacctcgacacctgggatacgtacttcggcgcccgctacacgcacggcacgcccttccgc
cgggccagcgaggaggggctgatcgatatggagcgctcacaacacatcggtatccgaggt
cctctctacagcaaaaaagacctcgaagacgacgatatgctcgggtttcagatcgtgcgg
tcggacgattaccagactgacggcgtggcaagcattatcgaccgcatgcgccgcagactc
ggaaccagtgcagacggcccggtctacgtctcgatcgatatcgatgtgctcgatcccgcg
ttcgcccccgggaccggcacgcccgaggccggcggtctgacgtcccgcgaattgctgcag
acacttcgcgggctcactgatatgaacatcgtcggcgccgacatcgtcgaagtcgcgcca
gcgtacgaccatgcggagatcaccggtatcgccgccgcccatgtcgcctacgaactgctt
tcggtcctcgcgctgaatcgtccgcgatag

DBGET integrated database retrieval system