KEGG   Amycolicicoccus subflavus: AS9A_1430Help
Entry
AS9A_1430         CDS       T01514                                 

Gene name
nadA
Definition
quinolinate synthetase
Orthology
K03517  
quinolinate synthase [EC:2.5.1.72]
Organism
asd  Amycolicicoccus subflavus
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Module
NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    AS9A_1430 (nadA)
Enzymes [BR:asd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.72  quinolinate synthase
     AS9A_1430 (nadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1488474..1489535
Genome map
AA seq 353 aa AA seqDB search
MTTATTAAPFLTETTLELLGQIEDGPGGFGGVTGGPDWAQEVRRLARERNATILAHNYQL
PEIQDVADHVGDSLALSRIAADAPESTIVFCGVHFMAETAKILSPEKTVLIPDQRAGCSL
ADSISADELREWKDEHPGAVVVSYVNTTAEVKALTDICCTSSNAVDVVASIEPDRDILFL
PDQFLGAHVKRVTGRKNLHIWAGECHVHAGINGDELAAQARSHPDADLFVHPECGCATSA
LYLAGEGAVPEDRVKILSTGGMLDAARSTGARQVLVATEVGMLHQLRRAAPDIDFQAVND
RASCKYMKMITPAALLRSLVENADEVHVDAETAAKARQSVQRMISIGNPGGGE
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgcgacaacagcagcgccgtttctgacggagacgacccttgaactgctcggc
cagatcgaggatggccccggcggcttcggcggggtcactggcgggccggactgggcccaa
gaagtgcggaggctcgcgcgtgaacgcaacgcgacgatccttgcgcacaactaccagctg
cccgaaatccaggatgttgccgaccacgtcggcgactcgctggcgctgtccagaattgct
gctgacgctccggagagcaccattgtgttctgcggtgtgcatttcatggccgaaaccgcg
aagatcctttcgccagagaagaccgtgctgataccggatcagcgcgctggttgctcgctt
gctgactctattagtgcggacgagctccgcgaatggaaagacgagcacccgggtgctgtt
gtggtgtcgtacgtcaacaccaccgcggaggtgaaagcgctgacagacatctgctgcacc
tcatcgaatgccgtcgacgtcgtcgcgtcgatagagcctgatcgcgacattctcttcctg
ccagaccagttcctcggggctcacgtcaagcgtgtcaccggacggaagaacctgcacatt
tgggccggcgaatgtcacgtccacgcaggcatcaacggcgatgagcttgccgcccaggcc
cgctcgcaccccgacgctgacctcttcgtgcaccccgagtgtggctgtgcgacatcagcg
ctgtacctcgctggcgagggagcggtgcccgaagatcgtgtgaagatcttgtccacgggt
ggcatgctcgacgccgctcggtcgactggcgctcgccaggttctcgttgccaccgaagtc
ggaatgctgcaccaactccgccgagcggcaccggacatcgactttcaggcagtcaacgat
cgagcttcatgcaagtacatgaagatgatcaccccggccgcgctgctgcgcagccttgtc
gaaaatgcggacgaggtacacgttgacgccgaaaccgcagcgaaggcacggcagtcggtg
cagcgcatgatctcgatcggtaatcccggcggcggtgagtga

DBGET integrated database retrieval system