KEGG   Amycolicicoccus subflavus: AS9A_1430Help
Entry
AS9A_1430         CDS       T01514                                 

Gene name
nadA
Definition
quinolinate synthetase
Orthology
K03517  
quinolinate synthase [EC:2.5.1.72]
Organism
asd  Amycolicicoccus subflavus
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Module
NAD biosynthesis, aspartate => NAD
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:asd00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1488474..1489535
Genome map
AA seq 353 aa AA seqDB search
MTTATTAAPFLTETTLELLGQIEDGPGGFGGVTGGPDWAQEVRRLARERNATILAHNYQL
PEIQDVADHVGDSLALSRIAADAPESTIVFCGVHFMAETAKILSPEKTVLIPDQRAGCSL
ADSISADELREWKDEHPGAVVVSYVNTTAEVKALTDICCTSSNAVDVVASIEPDRDILFL
PDQFLGAHVKRVTGRKNLHIWAGECHVHAGINGDELAAQARSHPDADLFVHPECGCATSA
LYLAGEGAVPEDRVKILSTGGMLDAARSTGARQVLVATEVGMLHQLRRAAPDIDFQAVND
RASCKYMKMITPAALLRSLVENADEVHVDAETAAKARQSVQRMISIGNPGGGE
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgcgacaacagcagcgccgtttctgacggagacgacccttgaactgctcggc
cagatcgaggatggccccggcggcttcggcggggtcactggcgggccggactgggcccaa
gaagtgcggaggctcgcgcgtgaacgcaacgcgacgatccttgcgcacaactaccagctg
cccgaaatccaggatgttgccgaccacgtcggcgactcgctggcgctgtccagaattgct
gctgacgctccggagagcaccattgtgttctgcggtgtgcatttcatggccgaaaccgcg
aagatcctttcgccagagaagaccgtgctgataccggatcagcgcgctggttgctcgctt
gctgactctattagtgcggacgagctccgcgaatggaaagacgagcacccgggtgctgtt
gtggtgtcgtacgtcaacaccaccgcggaggtgaaagcgctgacagacatctgctgcacc
tcatcgaatgccgtcgacgtcgtcgcgtcgatagagcctgatcgcgacattctcttcctg
ccagaccagttcctcggggctcacgtcaagcgtgtcaccggacggaagaacctgcacatt
tgggccggcgaatgtcacgtccacgcaggcatcaacggcgatgagcttgccgcccaggcc
cgctcgcaccccgacgctgacctcttcgtgcaccccgagtgtggctgtgcgacatcagcg
ctgtacctcgctggcgagggagcggtgcccgaagatcgtgtgaagatcttgtccacgggt
ggcatgctcgacgccgctcggtcgactggcgctcgccaggttctcgttgccaccgaagtc
ggaatgctgcaccaactccgccgagcggcaccggacatcgactttcaggcagtcaacgat
cgagcttcatgcaagtacatgaagatgatcaccccggccgcgctgctgcgcagccttgtc
gaaaatgcggacgaggtacacgttgacgccgaaaccgcagcgaaggcacggcagtcggtg
cagcgcatgatctcgatcggtaatcccggcggcggtgagtga

DBGET integrated database retrieval system