KEGG   Amycolicicoccus subflavus: AS9A_1438Help
Entry
AS9A_1438         CDS       T01514                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
asd  Amycolicicoccus subflavus
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:asd01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:asd00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1496237..1497577
Genome map
AA seq 446 aa AA seqDB search
MSPRSDLGRLDLRDRTPTTAELRASLPRGGVDVDSVLHHVRPVVEAVRDRGADAALEFGE
KFDRVRPDRIRVPAEELDKSLTGLDPRVRDALEVAIDRARTVHRDQRRTDTATEVVPGGT
VTERWIAVDRVGLYVPGGNAVYPSSVVMNVVPAQEAGVGSLVVTSPPQAEFGGLPHPTIL
AAAALLGVDEVWAVGGAQAVALLTYGGTDCDGAELEPVDMITGPGNIYVTAAKRLCRSLV
GIDAEAGPTEIAILADDTADPRHVAADLISQAEHDVLAASVLVTTSEELADAVDRAVAEQ
LHTTKHQERVATALSGKQSGIVLVSTIDDGIRAVNAYAAEHLEIQTRDAAAIAGKIRAAG
AIFVGPHSPVSLGDYCAGSNHVLPTAGCARHSSGLSVQTFLKGVHVIEYSEDALRDVARH
VIALAHAEDLPAHGDAVRARFPDSPS
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgtctccccgttccgatctcggtcgcctcgatttgcgtgaccgaacaccgactactgct
gagctgcgcgcgtcactgccgcgtggcggagtcgatgtggactcggtgctgcatcacgtc
cggccggtggtggaggctgtgcgcgaccgcggtgcggatgcagcactggaattcggtgag
aagttcgatcgcgtccgtccagaccggattcgcgtacctgccgaggaattggataaatca
ctgaccggactcgacccccgcgtgcgtgacgcgttggaggtcgctatcgatcgagcgcga
acagttcaccgcgatcagcgacgcactgacaccgcgacagaggtagttcccggtgggaca
gtgacggagcgatggatcgcggttgaccgggtcggtttgtacgtgcctggcggtaatgcc
gtgtacccgtcgagtgtggtgatgaacgttgttcccgcgcaggaagccggggtcgggtcg
ctcgtcgtgacgtcaccgccgcaagccgagttcggtggcctgccgcatccgacaattctt
gcggcggcggctctgctgggcgtggacgaggtgtgggcggtcggcggtgcgcaggctgtc
gcgctgctgacctatggtggaaccgattgtgacggtgctgaattagagccggtcgacatg
atcaccgggcccggcaatatctatgtgacggccgcaaagcggttgtgccgcagcctcgtt
gggattgatgcagaggctggtcccactgagattgcgatcctggctgacgacaccgccgac
ccgaggcacgtggcagcggatctgatcagtcaggcggaacacgacgttctcgccgcgagc
gtccttgtaacgacgagtgaagaactcgcggatgccgtcgacagagcggttgccgagcag
ctgcacacgacgaagcatcaggagcgagtagccaccgcgcttagtggaaagcagtccgga
attgtgctcgtgtcaacgatcgacgacggcatcagggccgtgaacgcatacgcagccgag
cacctcgagattcagacacgtgacgcggccgcgatcgcgggcaagatccgcgcggcaggc
gcgatcttcgtcgggccacactccccagtgagcctcggagactactgcgcgggatcgaac
cacgtgcttcccactgccggctgtgcgcgccactcgtccggactctcggttcagactttc
ctcaagggcgtccatgtcatcgagtacagcgaggacgcgttgcgtgacgtcgctcgccat
gtgattgccctcgcgcacgcggaggaccttccggcgcacggtgacgcagtgcgtgctcgc
ttccctgacagtcccagctaa

DBGET integrated database retrieval system