KEGG   Hoyosella subflava: AS9A_1438Help
Entry
AS9A_1438         CDS       T01514                                 

Gene name
hisD
Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
asd  Hoyosella subflava
Pathway
asd00340  Histidine metabolism
asd01100  Metabolic pathways
asd01110  Biosynthesis of secondary metabolites
asd01230  Biosynthesis of amino acids
Module
asd_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    AS9A_1438 (hisD)
Enzymes [BR:asd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     AS9A_1438 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh PSK_trans_fac
Motif
Other DBs
NCBI-ProteinID: AEF39890
UniProt: F6EH53
Position
1496237..1497577
Genome map
AA seq 446 aa AA seqDB search
MSPRSDLGRLDLRDRTPTTAELRASLPRGGVDVDSVLHHVRPVVEAVRDRGADAALEFGE
KFDRVRPDRIRVPAEELDKSLTGLDPRVRDALEVAIDRARTVHRDQRRTDTATEVVPGGT
VTERWIAVDRVGLYVPGGNAVYPSSVVMNVVPAQEAGVGSLVVTSPPQAEFGGLPHPTIL
AAAALLGVDEVWAVGGAQAVALLTYGGTDCDGAELEPVDMITGPGNIYVTAAKRLCRSLV
GIDAEAGPTEIAILADDTADPRHVAADLISQAEHDVLAASVLVTTSEELADAVDRAVAEQ
LHTTKHQERVATALSGKQSGIVLVSTIDDGIRAVNAYAAEHLEIQTRDAAAIAGKIRAAG
AIFVGPHSPVSLGDYCAGSNHVLPTAGCARHSSGLSVQTFLKGVHVIEYSEDALRDVARH
VIALAHAEDLPAHGDAVRARFPDSPS
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgtctccccgttccgatctcggtcgcctcgatttgcgtgaccgaacaccgactactgct
gagctgcgcgcgtcactgccgcgtggcggagtcgatgtggactcggtgctgcatcacgtc
cggccggtggtggaggctgtgcgcgaccgcggtgcggatgcagcactggaattcggtgag
aagttcgatcgcgtccgtccagaccggattcgcgtacctgccgaggaattggataaatca
ctgaccggactcgacccccgcgtgcgtgacgcgttggaggtcgctatcgatcgagcgcga
acagttcaccgcgatcagcgacgcactgacaccgcgacagaggtagttcccggtgggaca
gtgacggagcgatggatcgcggttgaccgggtcggtttgtacgtgcctggcggtaatgcc
gtgtacccgtcgagtgtggtgatgaacgttgttcccgcgcaggaagccggggtcgggtcg
ctcgtcgtgacgtcaccgccgcaagccgagttcggtggcctgccgcatccgacaattctt
gcggcggcggctctgctgggcgtggacgaggtgtgggcggtcggcggtgcgcaggctgtc
gcgctgctgacctatggtggaaccgattgtgacggtgctgaattagagccggtcgacatg
atcaccgggcccggcaatatctatgtgacggccgcaaagcggttgtgccgcagcctcgtt
gggattgatgcagaggctggtcccactgagattgcgatcctggctgacgacaccgccgac
ccgaggcacgtggcagcggatctgatcagtcaggcggaacacgacgttctcgccgcgagc
gtccttgtaacgacgagtgaagaactcgcggatgccgtcgacagagcggttgccgagcag
ctgcacacgacgaagcatcaggagcgagtagccaccgcgcttagtggaaagcagtccgga
attgtgctcgtgtcaacgatcgacgacggcatcagggccgtgaacgcatacgcagccgag
cacctcgagattcagacacgtgacgcggccgcgatcgcgggcaagatccgcgcggcaggc
gcgatcttcgtcgggccacactccccagtgagcctcggagactactgcgcgggatcgaac
cacgtgcttcccactgccggctgtgcgcgccactcgtccggactctcggttcagactttc
ctcaagggcgtccatgtcatcgagtacagcgaggacgcgttgcgtgacgtcgctcgccat
gtgattgccctcgcgcacgcggaggaccttccggcgcacggtgacgcagtgcgtgctcgc
ttccctgacagtcccagctaa

DBGET integrated database retrieval system