KEGG   Amycolicicoccus subflavus: AS9A_1456Help
Entry
AS9A_1456         CDS       T01514                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
asd  Amycolicicoccus subflavus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AS9A_1456
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AS9A_1456
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AS9A_1456
Enzymes [BR:asd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AS9A_1456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1509375..1510730
Genome map
AA seq 451 aa AA seqDB search
MQATRPRDVGQTGRVTSLDYKAAAQPGGKNMPRASAGLTERSTTDPDTRGHFGDYGGRFV
PEALMAVIEEVTAEYEKARADDTFLNELDRLHRDYSGRPSPLYEATRLSEQAGGARVFLK
REDLNHTGSHKINNVLGQALLAKRMGKTRVIAETGAGQHGVATATACALLGLDCVVYMGK
VDTDRQALNVARMRLLGAEVVAVETGSKTLKDAINEALRDWVTNASETYYCFGTVAGPHP
FPLMVRDFQRIIGLEAKTQISAMTGRLPDVVAACVGGGSNAIGIFHAFIGDTNVRLVGFE
AGGDGVETGRHAATISGGAPGALHGAYSYLLQDEDGQTTESHSISAGLDYPGVGPEHSYL
SDIGRAEYQSVTDSEAMDAFALLCRTEGIIPAIESAHAIAGALRLGKELGKGAIILVNLS
GRGDKDVETAAKWFGITGEATGQHESGGDGT
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggcaacacgccctcgcgatgtagggcagactggcagggtgacatcgctggattac
aaggcggcagcgcagcctggcggcaagaatatgccgcgcgcgagtgccggactgaccgaa
cgcagtacgaccgacccggatacccgcggccactttggtgactacggaggacggttcgtt
ccggaagcactgatggctgtgatcgaagaggtgacggccgagtacgagaaggctcgcgcg
gacgatacgtttctcaacgagctcgaccgcctccatcgtgactactccggtcgcccgtca
ccgttgtacgaggcgactcggctcagtgagcaagcgggcggtgcgcgggttttcctcaag
cgcgaggacctgaaccacactggctcgcacaagatcaacaatgttcttggccaggcgctg
ctcgcgaagcgaatgggcaaaacgagagtgatcgcggagactggggccggccagcacggc
gtggccaccgctaccgcctgtgcactgcttggactggactgcgtggtgtacatgggcaag
gtcgatactgaccgtcaggccctgaatgtggcgcggatgcgcttgctgggcgccgaagtg
gtggcggtggagactggatcgaagacgctgaaagacgcgatcaatgaggccctgcgtgac
tgggtgacgaacgccagtgagacctactactgctttggcacggttgcaggcccgcaccct
ttcccgcttatggtgcgagattttcagcgcatcattggcctggaggccaaaacacagatc
agcgcaatgactgggcggcttcccgatgtcgtcgccgcgtgcgtcggtggcggctccaac
gcgatcggcatcttccacgccttcatcggtgatacgaacgtccgcctcgtgggcttcgaa
gcgggcggtgacggtgtggaaactggtcggcatgcagcgactatcagcggcggtgcaccc
ggtgcgctgcacggcgcgtattcctacctgctccaggacgaggatggtcaaaccaccgaa
tcgcattcgatctctgccggtctggactaccccggtgttgggcctgagcattcgtacctg
agcgatattggccgggccgaataccagtccgtcactgattcggaggcaatggacgcgttt
gcgctgctatgccgcacagagggaatcatcccggcgattgagtccgcgcatgccatcgcg
ggtgcactgcgactcggaaaagaactaggcaaaggcgcgatcattctcgttaacctctcg
gggcgcggcgacaaggacgtggaaacggctgccaagtggttcggtattaccggcgaagcg
actggccagcatgagtcaggaggagacgggacgtga

DBGET integrated database retrieval system