KEGG   Amycolicicoccus subflavus: AS9A_1457Help
Entry
AS9A_1457         CDS       T01514                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
asd  Amycolicicoccus subflavus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AS9A_1457 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AS9A_1457 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AS9A_1457 (trpA)
Enzymes [BR:asd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AS9A_1457 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1510727..1511548
Genome map
AA seq 273 aa AA seqDB search
MTVTPHQEQSRLAPVFGRCHAESRSALVGYLPSGYPDKDGSRALFGAMVEGGCDIIEVGI
PYSDPVMDGPTIQAAANTALKSGFRVRDVFTTVENIASAGGNAVVMTYWNPVLRYGVDAF
ARDLAAAGGLGLITPDLIPEEAERWIAASRDHDLDRIFLVAPSSTEERIALTADVSRGFL
YAASTMGVTGARDAVSTSAPELVARIRAHSQIPIGIGLGVRSGAQAAEIARYADGVIVGS
ALVSAAKEGPDAVAELTRELAAGVRGAAQSATV
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
gtgacggtgactccgcatcaggaacaatctcgcctcgcaccggtattcgggcgatgccac
gcagagtcgcggtccgctctggtgggatatctcccttccgggtacccggacaaagacggc
tctcgcgcgctcttcggagcgatggtcgaaggcggctgcgacatcattgaagtaggcatc
ccgtattcggatccggtcatggacggcccgacaattcaggcggcggcaaatacggccctg
aaatctggattccgcgtgcgcgatgtgttcacaacggtagagaacatcgccagcgccggt
ggcaacgctgtggtgatgacctactggaaccctgtccttcgctacggtgtggacgcgttc
gcacgtgatctagctgcggccggcggcctcggcctgatcactccggatcttattccggaa
gaagcagagcgctggatcgccgcttcacgcgaccacgacctcgaccggatcttccttgtc
gccccgtcgtcgaccgaggaacgaatcgcgttgaccgcggatgtgagccgaggtttcctc
tacgcagcctcaacgatgggtgtcacgggcgcgcgggacgcagtatcgacatccgctccg
gagctcgtggcgcgtatccgcgcacacagccagattccaatcgggatcggcctcggcgtc
agaagtggtgcgcaggcagcagagatcgctcgatacgcagacggagtgattgtcggctcc
gcgctggtttcggcggctaaggaaggcccagacgcggttgctgagctcactcgggaactt
gcagccggggtacgtggcgcagcccagtcagctaccgtgtga

DBGET integrated database retrieval system