KEGG   Amycolicicoccus subflavus: AS9A_1457Help
Entry
AS9A_1457         CDS       T01514                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
asd  Amycolicicoccus subflavus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:asd01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:asd00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:asd00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1510727..1511548
Genome map
AA seq 273 aa AA seqDB search
MTVTPHQEQSRLAPVFGRCHAESRSALVGYLPSGYPDKDGSRALFGAMVEGGCDIIEVGI
PYSDPVMDGPTIQAAANTALKSGFRVRDVFTTVENIASAGGNAVVMTYWNPVLRYGVDAF
ARDLAAAGGLGLITPDLIPEEAERWIAASRDHDLDRIFLVAPSSTEERIALTADVSRGFL
YAASTMGVTGARDAVSTSAPELVARIRAHSQIPIGIGLGVRSGAQAAEIARYADGVIVGS
ALVSAAKEGPDAVAELTRELAAGVRGAAQSATV
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
gtgacggtgactccgcatcaggaacaatctcgcctcgcaccggtattcgggcgatgccac
gcagagtcgcggtccgctctggtgggatatctcccttccgggtacccggacaaagacggc
tctcgcgcgctcttcggagcgatggtcgaaggcggctgcgacatcattgaagtaggcatc
ccgtattcggatccggtcatggacggcccgacaattcaggcggcggcaaatacggccctg
aaatctggattccgcgtgcgcgatgtgttcacaacggtagagaacatcgccagcgccggt
ggcaacgctgtggtgatgacctactggaaccctgtccttcgctacggtgtggacgcgttc
gcacgtgatctagctgcggccggcggcctcggcctgatcactccggatcttattccggaa
gaagcagagcgctggatcgccgcttcacgcgaccacgacctcgaccggatcttccttgtc
gccccgtcgtcgaccgaggaacgaatcgcgttgaccgcggatgtgagccgaggtttcctc
tacgcagcctcaacgatgggtgtcacgggcgcgcgggacgcagtatcgacatccgctccg
gagctcgtggcgcgtatccgcgcacacagccagattccaatcgggatcggcctcggcgtc
agaagtggtgcgcaggcagcagagatcgctcgatacgcagacggagtgattgtcggctcc
gcgctggtttcggcggctaaggaaggcccagacgcggttgctgagctcactcgggaactt
gcagccggggtacgtggcgcagcccagtcagctaccgtgtga

DBGET integrated database retrieval system