KEGG   Amycolicicoccus subflavus: AS9A_1506Help
Entry
AS9A_1506         CDS       T01514                                 

Gene name
argC
Definition
N-acetyl-gamma-glutamyl-phosphate reductase
Orthology
K00145  
N-acetyl-gamma-glutamyl-phosphate reductase [EC:1.2.1.38]
Organism
asd  Amycolicicoccus subflavus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Ornithine biosynthesis, glutamate => ornithine
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:asd01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:asd01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:asd00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1566028..1567065
Genome map
AA seq 345 aa AA seqDB search
MGTRIAVAGASGYAGGEVLRLLLGHPAYADGRLEIGALTAGGNAGSTLGEHHPHLLPLAE
RVLEDTSAATLADHDVIFLGLPHGHSAALAAELPESIVIIDCGADFRLRNAQDWESFYGS
PHAGAWPYGLPELPGARESLQGATRIAVPGCYPTATSLALAPAIASGIVTPAVTIVAVTG
ASGAGRSLRTDLLGSEVMGSVRAYGVGGVHRHTPEIRQNLQSLTVEDVSVSFTPVLAPMA
RGILATCVAPTTVDDTEARAVYEKAYADEPFVHLLPPGRLPQTSAVLGSNAVHLSVHVDR
AAGTLVVVSAIDNLTKGTAGGAVQSMNIALGLPETAGLSTVGVAP
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgggtacgaggattgctgtcgcaggcgcgagtggatacgcgggtggagaggtcctccgg
ttgcttctcgggcatccggcatatgccgacggcaggctagagatcggcgcgctgactgcc
ggcgggaatgccggatcaacactcggggagcaccatccgcacctgctgccactcgctgag
agggtcctcgaagacacctcggccgcaactcttgccgaccatgatgtgatttttctcggt
ctgccccacggtcattcggcggcgctcgctgcggagcttccggagtcgatcgtcatcatc
gactgtggtgcggattttcgcctgcgaaatgcccaggactgggagagtttttacggttcg
ccccatgctggcgcgtggccgtatggactgcccgaacttccgggcgcgcgggaatcgctg
caaggtgcgacgcgcatcgcggtgcccggttgctatccaaccgcaacgtcgcttgcgttg
gcgcccgctattgcttcgggcatcgtgacgcccgcggtgactatcgtggctgtgactggc
gcatctggagccggacgatccctgcgtacggatctgcttggctccgaggtgatggggtcc
gtgcgcgcctacggcgtgggtggtgtccaccggcacacgccggagatcagacaaaacctg
cagtcactcaccgtggaggacgtcagtgtgtcgttcactccggtgctcgctccgatggct
cgcggaatccttgctacgtgcgttgcgcccacgaccgttgacgacactgaggcacgcgcg
gtatacgaaaaggcctatgcggacgagccgttcgtgcacctcctcccgccggggcggtta
ccgcagactagtgcggtgctcggctccaacgcggtacacctcagtgttcacgtggaccgt
gctgctgggactctcgttgtcgtatccgcgattgacaacctcactaaaggcaccgcaggc
ggggccgtacagtcgatgaacatcgcgctcggcttgccggaaacagccgggctgtcaacg
gtgggagtagctccatga

DBGET integrated database retrieval system