KEGG   Amycolicicoccus subflavus: AS9A_1506Help
Entry
AS9A_1506         CDS       T01514                                 

Gene name
argC
Definition
N-acetyl-gamma-glutamyl-phosphate reductase
Orthology
K00145  
N-acetyl-gamma-glutamyl-phosphate reductase [EC:1.2.1.38]
Organism
asd  Amycolicicoccus subflavus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    AS9A_1506 (argC)
   01230 Biosynthesis of amino acids
    AS9A_1506 (argC)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AS9A_1506 (argC)
Enzymes [BR:asd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.38  N-acetyl-gamma-glutamyl-phosphate reductase
     AS9A_1506 (argC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1566028..1567065
Genome map
AA seq 345 aa AA seqDB search
MGTRIAVAGASGYAGGEVLRLLLGHPAYADGRLEIGALTAGGNAGSTLGEHHPHLLPLAE
RVLEDTSAATLADHDVIFLGLPHGHSAALAAELPESIVIIDCGADFRLRNAQDWESFYGS
PHAGAWPYGLPELPGARESLQGATRIAVPGCYPTATSLALAPAIASGIVTPAVTIVAVTG
ASGAGRSLRTDLLGSEVMGSVRAYGVGGVHRHTPEIRQNLQSLTVEDVSVSFTPVLAPMA
RGILATCVAPTTVDDTEARAVYEKAYADEPFVHLLPPGRLPQTSAVLGSNAVHLSVHVDR
AAGTLVVVSAIDNLTKGTAGGAVQSMNIALGLPETAGLSTVGVAP
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgggtacgaggattgctgtcgcaggcgcgagtggatacgcgggtggagaggtcctccgg
ttgcttctcgggcatccggcatatgccgacggcaggctagagatcggcgcgctgactgcc
ggcgggaatgccggatcaacactcggggagcaccatccgcacctgctgccactcgctgag
agggtcctcgaagacacctcggccgcaactcttgccgaccatgatgtgatttttctcggt
ctgccccacggtcattcggcggcgctcgctgcggagcttccggagtcgatcgtcatcatc
gactgtggtgcggattttcgcctgcgaaatgcccaggactgggagagtttttacggttcg
ccccatgctggcgcgtggccgtatggactgcccgaacttccgggcgcgcgggaatcgctg
caaggtgcgacgcgcatcgcggtgcccggttgctatccaaccgcaacgtcgcttgcgttg
gcgcccgctattgcttcgggcatcgtgacgcccgcggtgactatcgtggctgtgactggc
gcatctggagccggacgatccctgcgtacggatctgcttggctccgaggtgatggggtcc
gtgcgcgcctacggcgtgggtggtgtccaccggcacacgccggagatcagacaaaacctg
cagtcactcaccgtggaggacgtcagtgtgtcgttcactccggtgctcgctccgatggct
cgcggaatccttgctacgtgcgttgcgcccacgaccgttgacgacactgaggcacgcgcg
gtatacgaaaaggcctatgcggacgagccgttcgtgcacctcctcccgccggggcggtta
ccgcagactagtgcggtgctcggctccaacgcggtacacctcagtgttcacgtggaccgt
gctgctgggactctcgttgtcgtatccgcgattgacaacctcactaaaggcaccgcaggc
ggggccgtacagtcgatgaacatcgcgctcggcttgccggaaacagccgggctgtcaacg
gtgggagtagctccatga

DBGET integrated database retrieval system