KEGG   Amycolicicoccus subflavus: AS9A_1609Help
Entry
AS9A_1609         CDS       T01514                                 

Definition
putative magnesium chelatase subunit
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
asd  Amycolicicoccus subflavus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AS9A_1609
Enzymes [BR:asd01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     AS9A_1609
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1670974..1672914
Genome map
AA seq 646 aa AA seqDB search
MTHAVSAERGFPFSAIVGQDQLRLALILCAIHPGIGGVLVRGEKGTAKSTVVRALARLLP
PVRSQEGPRAARLVELPVGATEDRVVGSIDLERVLRDGERAFQPGLLAHAHEGVLYVDEV
NLLHDHLVDVLLDAAAMGRVHVERDGFSHTHPARFVLVGTMNPEEGELRPQLLDRFGLTV
DVSASRDVGVRAEVIRRRLEYERDPDRFAARFDGQDTQLAERIAIARDALDSVTLPDREV
RRIASLCAEFGVDGMRADLVMARTAIAHAAWRGAVEAGEDDIRAAAELTLPHRQRRDPFD
EPGLDQNQLDDAMTKAAQDADSGGPEPDPDDPGPDDPDPNDPGPQDPGPPTSGGHTPPGS
GDSAAESADESTGGSSDNAPERKSAPPQGSFRARLLEIPGTGEGAPGRRSRARSQRGRIV
RPAAFRGRALHVPATILEAAAQLRSRGRFSVRPTDLRGAEHEGREGNLVVFVVDASGSMA
ARDRLSAVTGAVVSLLRDAYQRRDKVAVITLRGRQAELVLPPTSSIDIAVRRLDSLRTGG
RTPLAEGLVKAREVVLRERVRDAQRRALVVLLTDGRATAGAEPVKRAHRAARLVVDAGIA
SVTVDCEHGMVRLGLAADLSRHLQGGYVRLAELSADAVTGVVRAAA
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgacccacgccgttagcgctgaacgagggttccccttcagcgcaatcgtcggacaggac
cagttgcgcctcgcgctgattctgtgtgcgatccaccccggtatcggcggtgtgctcgta
cgtggcgagaagggcaccgcaaaatcgacagtggttcgcgcgctcgcaaggctgctgccg
cccgttcgatcacaagagggtccacgtgcggcgcgactcgttgaactcccagtgggtgcc
accgaggaccgcgtggtcgggtcaatcgacctggaacgcgtgcttcgcgacggcgaacgg
gcattccagcccggtctgctggcgcacgcacacgaaggtgtgctgtacgtcgacgaagtg
aatttgctgcacgaccatctggttgacgttctgctcgatgcggccgcgatgggcagagtg
cacgtcgaacgcgatggcttctcgcacacgcatcccgccaggttcgttctcgtggggaca
atgaacccggaagagggtgagctgcggccccagttgctggaccgattcggccttaccgtc
gatgtctcggcttcacgtgatgtaggtgtgcgagcggaagtgatccggcgccgcctcgaa
tatgaacgggaccccgatcggttcgccgctcgattcgacggccaggacacccaattggcg
gagcgcatcgcaattgcacgcgacgcgctcgattcggtcactctgcctgaccgggaggtg
cggcgcatcgcctcactgtgcgccgagttcggtgtcgacggaatgcgcgccgacctagtg
atggcacgcaccgcgatcgcgcatgcggcatggcgcggcgcggtcgaagcaggagaagac
gacatccgtgctgcagcggaactgaccctgccgcaccgacagcgcagggaccccttcgac
gaacccggtcttgatcagaaccagctagacgacgcgatgacgaaggcagcccaggacgcg
gattctgggggccccgagcccgacccagatgaccccggcccagacgatccggaccctaac
gatcctggcccccaggacccgggcccgccgacttccggggggcacacacctcctggcagc
ggcgactcggctgccgagagtgcagacgagagcactggtggctcctcagacaacgcgccc
gagcgcaagtcagcgccgcctcagggatcgttccgggcgcgtctgctcgagataccggga
acaggagaaggggcgcctgggcgtcgatctcgagcacggtcgcagcgaggacgaatcgtg
cgtccggcggcctttcgcgggcgggccctacacgttccggcgaccattcttgaagccgcg
gcgcagctgcggagccgcggccggttctcggtgcggcccacagatttgcggggcgccgaa
cacgaaggcagggaaggcaacctcgtagtatttgttgttgacgcctcgggctcgatggcc
gcacgtgaccgcctttcggcggtcaccggggcggtcgtttccctgcttcgtgacgcttat
cagaggcgagacaaggtagccgtgatcaccttgcgggggcgtcaagctgaactcgtcttg
cccccgacatcgtcgatcgatatcgcggttcgcaggctcgattcgctgcgcaccggcggg
cgcaccccactggccgaaggtcttgtcaaagcacgcgaggtcgtgctgcgcgagcgtgtt
cgtgacgcgcagcgacgggcgctcgtggtcctcctgacggacgggcgcgccactgcggga
gcggaaccggtaaaacgagcgcaccgggctgcgcggctcgtggtcgacgcgggaattgcg
tccgtcaccgtggactgtgaacatggaatggttcgcctcgggctcgcggccgacctttct
cgtcacctccaaggcggatacgtgcggctggctgagctttcagcggatgctgtcaccggt
gtcgtccgcgcggccgcatag

DBGET integrated database retrieval system