KEGG   Hoyosella subflava: AS9A_1609Help
Entry
AS9A_1609         CDS       T01514                                 

Definition
(GenBank) Putative magnesium chelatase subunit
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
asd  Hoyosella subflava
Pathway
asd00860  Porphyrin and chlorophyll metabolism
asd01100  Metabolic pathways
asd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AS9A_1609
Enzymes [BR:asd01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     AS9A_1609
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 Mg_chelatase AAA_5 VWA MCM Sigma54_activat VWA_3 AAA_16 AAA_22 AAA AAA_3 AAA_29
Motif
Other DBs
NCBI-ProteinID: AEF40058
UniProt: F6EIZ7
Position
1670974..1672914
Genome map
AA seq 646 aa AA seqDB search
MTHAVSAERGFPFSAIVGQDQLRLALILCAIHPGIGGVLVRGEKGTAKSTVVRALARLLP
PVRSQEGPRAARLVELPVGATEDRVVGSIDLERVLRDGERAFQPGLLAHAHEGVLYVDEV
NLLHDHLVDVLLDAAAMGRVHVERDGFSHTHPARFVLVGTMNPEEGELRPQLLDRFGLTV
DVSASRDVGVRAEVIRRRLEYERDPDRFAARFDGQDTQLAERIAIARDALDSVTLPDREV
RRIASLCAEFGVDGMRADLVMARTAIAHAAWRGAVEAGEDDIRAAAELTLPHRQRRDPFD
EPGLDQNQLDDAMTKAAQDADSGGPEPDPDDPGPDDPDPNDPGPQDPGPPTSGGHTPPGS
GDSAAESADESTGGSSDNAPERKSAPPQGSFRARLLEIPGTGEGAPGRRSRARSQRGRIV
RPAAFRGRALHVPATILEAAAQLRSRGRFSVRPTDLRGAEHEGREGNLVVFVVDASGSMA
ARDRLSAVTGAVVSLLRDAYQRRDKVAVITLRGRQAELVLPPTSSIDIAVRRLDSLRTGG
RTPLAEGLVKAREVVLRERVRDAQRRALVVLLTDGRATAGAEPVKRAHRAARLVVDAGIA
SVTVDCEHGMVRLGLAADLSRHLQGGYVRLAELSADAVTGVVRAAA
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgacccacgccgttagcgctgaacgagggttccccttcagcgcaatcgtcggacaggac
cagttgcgcctcgcgctgattctgtgtgcgatccaccccggtatcggcggtgtgctcgta
cgtggcgagaagggcaccgcaaaatcgacagtggttcgcgcgctcgcaaggctgctgccg
cccgttcgatcacaagagggtccacgtgcggcgcgactcgttgaactcccagtgggtgcc
accgaggaccgcgtggtcgggtcaatcgacctggaacgcgtgcttcgcgacggcgaacgg
gcattccagcccggtctgctggcgcacgcacacgaaggtgtgctgtacgtcgacgaagtg
aatttgctgcacgaccatctggttgacgttctgctcgatgcggccgcgatgggcagagtg
cacgtcgaacgcgatggcttctcgcacacgcatcccgccaggttcgttctcgtggggaca
atgaacccggaagagggtgagctgcggccccagttgctggaccgattcggccttaccgtc
gatgtctcggcttcacgtgatgtaggtgtgcgagcggaagtgatccggcgccgcctcgaa
tatgaacgggaccccgatcggttcgccgctcgattcgacggccaggacacccaattggcg
gagcgcatcgcaattgcacgcgacgcgctcgattcggtcactctgcctgaccgggaggtg
cggcgcatcgcctcactgtgcgccgagttcggtgtcgacggaatgcgcgccgacctagtg
atggcacgcaccgcgatcgcgcatgcggcatggcgcggcgcggtcgaagcaggagaagac
gacatccgtgctgcagcggaactgaccctgccgcaccgacagcgcagggaccccttcgac
gaacccggtcttgatcagaaccagctagacgacgcgatgacgaaggcagcccaggacgcg
gattctgggggccccgagcccgacccagatgaccccggcccagacgatccggaccctaac
gatcctggcccccaggacccgggcccgccgacttccggggggcacacacctcctggcagc
ggcgactcggctgccgagagtgcagacgagagcactggtggctcctcagacaacgcgccc
gagcgcaagtcagcgccgcctcagggatcgttccgggcgcgtctgctcgagataccggga
acaggagaaggggcgcctgggcgtcgatctcgagcacggtcgcagcgaggacgaatcgtg
cgtccggcggcctttcgcgggcgggccctacacgttccggcgaccattcttgaagccgcg
gcgcagctgcggagccgcggccggttctcggtgcggcccacagatttgcggggcgccgaa
cacgaaggcagggaaggcaacctcgtagtatttgttgttgacgcctcgggctcgatggcc
gcacgtgaccgcctttcggcggtcaccggggcggtcgtttccctgcttcgtgacgcttat
cagaggcgagacaaggtagccgtgatcaccttgcgggggcgtcaagctgaactcgtcttg
cccccgacatcgtcgatcgatatcgcggttcgcaggctcgattcgctgcgcaccggcggg
cgcaccccactggccgaaggtcttgtcaaagcacgcgaggtcgtgctgcgcgagcgtgtt
cgtgacgcgcagcgacgggcgctcgtggtcctcctgacggacgggcgcgccactgcggga
gcggaaccggtaaaacgagcgcaccgggctgcgcggctcgtggtcgacgcgggaattgcg
tccgtcaccgtggactgtgaacatggaatggttcgcctcgggctcgcggccgacctttct
cgtcacctccaaggcggatacgtgcggctggctgagctttcagcggatgctgtcaccggt
gtcgtccgcgcggccgcatag

DBGET integrated database retrieval system