KEGG   Amycolicicoccus subflavus: AS9A_1765Help
Entry
AS9A_1765         CDS       T01514                                 

Definition
polyphosphate glucokinase
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
asd  Amycolicicoccus subflavus
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:asd01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:asd00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:asd00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1835967..1836749)
Genome map
AA seq 260 aa AA seqDB search
MHTEPQTPSADSPPPRLGLGVDIGGSGVKGAVVNLETGVLATERIRIDTPQPATPGAVAA
TVAAIVKEFDWDGPVGVTVPAVVKHGVTYSAANIDPTWIGTDARALFTAELDGRKVTVLN
DADAAGLAEQKFGSGRDENGLVILLTFGTGIGSALLYNGILIPNSELGHLEVGGKKAEHR
AAASVRERNDLSWTDWAAEVSTVLSTYDALFSPDLFIAGGGVSKKSDKWIPLLTTQTRII
PAQLRNTAGIVGGAVAAYSD
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcacaccgagccacagacaccgtccgccgacagcccgccaccccggctgggtctgggt
gttgatatcggcggcagcggcgtcaaaggtgccgtcgtgaaccttgaaaccggagtgctg
gccactgagcgtatccggattgacacccctcagcccgcgacccccggagcggtcgcagca
actgtggcggcgatcgtgaaggagttcgactgggacgggcccgttggcgtcaccgttccc
gcggtcgtcaaacatggcgtgacatacagcgccgcaaacatcgaccccacatggataggt
acggacgctcgggctctcttcacagcagaactcgacgggcggaaggtcactgtccttaac
gatgccgatgcggcgggactcgccgaacagaagttcggatctggccgtgacgagaacggc
ctcgtcatcctgttgactttcgggacaggtatcggttcagcgctgctctacaacggaatt
ctgattccgaatagcgagctgggccatctggaagtcggcggaaaaaaagcggagcaccgt
gccgcggcatctgttcgtgaacgcaatgatctgagctggacggactgggccgcggaggta
tccaccgtgctcagcacctacgatgcgctcttctccccggacctcttcatcgcgggcggc
ggcgtgagcaaaaaaagtgacaagtggatcccgctcctgacaacgcaaacgcgcatcatc
ccagcccagttgcgtaacaccgcgggaatcgtgggcggggccgttgccgcatattcggat
taa

DBGET integrated database retrieval system