KEGG   Amycolicicoccus subflavus: AS9A_1815Help
Entry
AS9A_1815         CDS       T01514                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
asd  Amycolicicoccus subflavus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:asd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    AS9A_1815 (ruvA)
Enzymes [BR:asd01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     AS9A_1815 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1880335..1880940
Genome map
AA seq 201 aa AA seqDB search
MIASIRGPVLSIGLDHAVLEAAGVGYRINATPGTLSTLSRGSDARLLTTMVVREDSMTLY
GFPDEESRELFTLLQTVTGVGPRLAMAVLAVLEPQLLRTALAEGDVRALTRVPGVGKRVA
ERLVVDLRDKVGPVHPSTTDAPIVGPRSSSVVQDQVAEALVGLGFSAAQAEQATAEAAQL
QPEASNSTLLRTALASLGKNK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgattgcctcgatccgggggccggtgctttctatcggtctcgatcacgccgtccttgaa
gctgctggcgtggggtaccgcatcaatgcgactccggggacgctgtcaacgttgtcacga
ggttcggatgctcgcctgctcaccacgatggtggttcgcgaagactcgatgacgctttac
gggtttcctgatgaggaatcacgtgagttgttcaccttgctgcagacagttaccggggtg
gggccacgcctcgccatggccgtgctcgcagtgctcgagccgcagctactgcgtactgcg
ctggcggagggtgacgtccgagcattgaccagggtcccaggggtaggtaagcgggtggct
gagcgtctggtcgtcgacctccgtgacaaagttggtcctgtgcacccgagtacgacggac
gcaccgatcgtgggcccgcggagtagtagcgttgtgcaagaccaggtggctgaagcgctg
gtcgggctgggattcagcgcagcgcaggcagaacaggcgacggctgaagcggcgcaattg
cagcccgaggcgtcgaactcaacgctgctgcgtaccgctctcgcttccctggggaagaac
aaatga

DBGET integrated database retrieval system