KEGG   Amycolicicoccus subflavus: AS9A_1832Help
Entry
AS9A_1832         CDS       T01514                                 

Definition
fomramidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
asd  Amycolicicoccus subflavus
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:asd03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1899125..1899994
Genome map
AA seq 289 aa AA seqDB search
MPELPEVEAIAHFLRKHAVGMGIARIDVSQISVLKTFDPPIDALRERTVSGVQRCGKYLA
LVCAQPGDSEIFLVFHLARAGWLRWSDALSPAAPKPGRGPIALRIHLSGGGGLDLTEAGT
KKNLAVWVTRDLAALHQIERLGTDALEITESELSGKLQGSSARLKTFLTDQTVLSGIGNA
YSDEILHLAKLSPFAQANSLSEEAAQNLHTAIYAVLSDAVTRCVGESVARLKGEKRSGLR
VHARTGLPCPECGAPVREVAYADRSFQYCAQCQTGGKVLADRRMSRLLK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgaacttcctgaagtagaagctatcgcgcactttctgcgcaagcacgccgtgggg
atggggatcgcgcgtattgatgtctctcagattagcgtgctgaaaacgttcgacccgcca
atcgatgcgctccgtgaacgtacggtctcgggcgtacagcgctgcggaaagtacctggcg
ctagtgtgcgctcaacctggagacagtgagatcttcctggtcttccaccttgcgcgcgct
gggtggctgcgctggtccgatgcgttgtcccctgcagcgccgaaacctggccgcggaccg
attgcgttgcgaattcacctgagcggcggaggcgggctcgacctcaccgaggccgggacc
aagaagaatctggccgtgtgggtgacccgtgatctcgctgcacttcatcaaatcgagaga
ttgggaactgacgcgctcgagatcacggaatcggaactcagcggaaaactccagggttcg
tcagcacggttgaagacgtttctcaccgaccagacagttctctcgggcatcggaaatgcc
tactccgacgagattctgcacctcgccaagctatcgccattcgcccaggcgaattcgttg
tccgaggaagccgcccagaatctgcacacggccatctacgcggtcctctccgatgcagtg
acaaggtgcgtgggcgagagtgttgccaggctgaagggggagaagcggtcaggcttgcga
gtgcatgcccggacagggttgccatgcccagagtgtggtgctcccgttagggaggttgcc
tatgccgaccgttcatttcagtactgcgcgcaatgccagaccggcgggaaggttctggct
gaccgcaggatgtctcgactactgaaatag

DBGET integrated database retrieval system